SecReT4
Protein ID: 84060753
T4SS name [ID]Tra_F [113]
Gene symboltraX
Locus tagO2ColV109
StrainEscherichia coli plasmid pAPEC-O2-ColV (NC_007675)
Repliconplasmid pAPEC-O2-ColV [GenBank: NC_007675] [Browse all T4SS(s) in this replicon]
Location [Strand]6566..7312 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ5JBP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 7.6e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|84060753|ref|YP_443955.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|84060731|ref|NC_007675.1|:c7312-6566 Escherichia coli A2363 plasmid pAPEC-O2-ColV, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGATTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACATGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design