SecReT4
Protein ID: 84060762
T4SS name [ID]Tra_F [113]
Gene symboltraQ
Locus tagO2ColV118
StrainEscherichia coli plasmid pAPEC-O2-ColV (NC_007675)
Repliconplasmid pAPEC-O2-ColV [GenBank: NC_007675] [Browse all T4SS(s) in this replicon]
Location [Strand]21348..21632 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ2TU01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 4.7e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|84060762|ref|YP_443964.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALXARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|84060731|ref|NC_007675.1|:c21632-21348 Escherichia coli A2363 plasmid pAPEC-O2-ColV, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTTAT
TGCGGCCATTCTCGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGWAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design