SecReT4
Protein ID: 84060764
T4SS name [ID]Tra_F [113]
Gene symboltraF
Locus tagO2ColV120
StrainEscherichia coli plasmid pAPEC-O2-ColV (NC_007675)
Repliconplasmid pAPEC-O2-ColV [GenBank: NC_007675] [Browse all T4SS(s) in this replicon]
Location [Strand]22114..22857 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ5JBN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.9e-78, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|84060764|ref|YP_443966.1| conjugal pilus assembly protein TraF [Escherichia coli]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAVPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|84060731|ref|NC_007675.1|:c22857-22114 Escherichia coli A2363 plasmid pAPEC-O2-ColV, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCAAAGGAAAAAGAAAATAAACCTGTACCTGCAGTCCCACGTCA
GGAGCCGGATATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCTATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAGGCGCAGCAGCGACAGGCTATTGCGAAACTG
GCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGTGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGTCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAA
AACAATTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design