SecReT4
Protein ID: 84310692
T4SS name [ID]Trb [72]
Gene symboltrbG
Locus tagpTP6_27
Strainuncultured bacterium plasmid pTP6 (NC_007680)
Repliconplasmid pTP6 [GenBank: NC_007680] [Browse all T4SS(s) in this replicon]
Location [Strand]18019..18939 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ7X3E7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-66, Aligned region: 80..305
Protein Sequence: 306 a.a.     [Download]
>gi|84310692|ref|YP_447022.1| conjugal transfer protein TrbG [uncultured bacterium]
MNSRSSTMKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIK
PVAGSGGAIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKP
MDVGLETSLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGD
LSFDYELSGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIV
DTVFDRAILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|84310666|ref|NC_007680.1|:18019-18939 Uncultured bacterium plasmid pTP6, complete sequence
ATGAATTCGAGGTCATCCACCATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGC
CCTCCCTGGCTCTGGCCGCCCCTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCT
GACCGCTCAAGAGCGCGCGGCGCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAG
CCGGTGGCCGGCTCGGGCGGTGCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGG
TGCTCCAGGTGTGCGACGTGGCCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGC
CAGGTGGACGGTGGAACCGGCCATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCG
ATGGACGTGGGCCTCGAAACCAGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCT
CGCATCGCACCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGC
GATCCAGCGCCGCGAGAAGCAGGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGAT
CTCTCGTTCGACTATGAGCTGTCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCA
AGACCATCATCGAAATGCCCGGCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGA
GGGCGGCTTGTTCACCGACGACGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTG
GACACGGTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCC
GGAGGAAGTGA
 Primer design