SecReT4
Protein ID: 85372997
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00850
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]206973..207785 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ2NDH9
KEGG IDeli:ELI_00850
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7.1e-68, Aligned region: 47..259
Protein Sequence: 270 a.a.     [Download]
>gi|85372997|ref|YP_457059.1| hypothetical protein ELI_00850 [Erythrobacter litoralis HTCC2594]
MTHLYLLTALALGFAALPAAPALAQERQETASTTAADALYCEERRLGYWFYCVKPVPAEEPQAPEIEPVA
ATQELDAITAELRELKARAIVYPTEANVAAYIRLQRAQLDRASLFSDVWQRAIWQDPELDYTLERPVGAL
AKKQWQDARSAERDSVMARLSQRYGLFYFYSSTCAPCEVMSPIVKGVAERWRITVRAISTDGGPSRHFPD
YKVETNQRARLGLEGKATPALVLWDSVTKRPIPIGYGVLSADELQDRIYLLTSKEAGHDY
 
Nucleotide Sequence: 813 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c207785-206973 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGACCCATCTCTATCTCCTCACCGCGCTTGCGCTTGGCTTCGCTGCGCTCCCCGCCGCTCCGGCCCTGG
CCCAGGAAAGGCAGGAAACTGCATCGACCACCGCGGCTGACGCGCTCTACTGCGAAGAGCGCAGGCTCGG
CTACTGGTTCTACTGCGTCAAACCTGTGCCCGCGGAGGAACCGCAAGCGCCTGAAATCGAGCCGGTCGCG
GCGACGCAGGAACTCGATGCGATCACCGCCGAGCTACGCGAGTTGAAGGCCCGCGCGATCGTCTATCCCA
CCGAAGCGAATGTGGCGGCCTATATCCGCCTCCAGCGCGCGCAGCTCGATCGCGCCTCGCTCTTCTCCGA
TGTCTGGCAGCGCGCGATCTGGCAGGACCCCGAACTCGACTACACGCTCGAGCGGCCGGTCGGCGCGCTC
GCAAAGAAACAGTGGCAGGATGCCCGCAGCGCCGAGCGCGACAGCGTGATGGCGCGGCTCTCGCAGCGCT
ACGGCCTGTTCTATTTCTACAGCTCGACCTGCGCACCCTGCGAAGTGATGAGCCCGATCGTCAAGGGCGT
CGCCGAGCGCTGGCGCATCACCGTGCGCGCGATCTCGACCGATGGCGGACCCTCGCGCCATTTCCCGGAC
TACAAGGTCGAGACCAACCAGCGCGCCAGGCTCGGCCTCGAAGGCAAGGCCACGCCGGCGCTCGTGCTGT
GGGACAGCGTGACCAAGCGACCGATCCCGATCGGTTACGGCGTGCTCTCGGCCGACGAACTCCAGGACCG
CATCTACCTCCTCACCTCGAAGGAAGCCGGACATGATTACTAG
 Primer design