SecReT4
Protein ID: 85373011
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00920
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]219853..220140 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ2NDG5
KEGG IDeli:ELI_00920
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.5e-31, Aligned region: 3..94
Protein Sequence: 95 a.a.     [Download]
>gi|85373011|ref|YP_457073.1| hypothetical protein ELI_00920 [Erythrobacter litoralis HTCC2594]
MADRYLVPRRLDDPELIGFWTIDEFAGLLVPFAWGILAQHIIIGTALSGLTWFALRKAKASGAGSKLVHA
AYWYLPGSFLGLKATPPSHCRLLAG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c220140-219853 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGCCGACAGATACCTCGTTCCACGGCGGCTCGACGATCCGGAACTCATCGGTTTCTGGACCATCGACG
AGTTTGCGGGACTCCTCGTCCCCTTCGCCTGGGGCATTCTCGCGCAGCACATCATCATCGGCACAGCCCT
GTCCGGGCTCACCTGGTTCGCCCTTCGAAAGGCGAAGGCGTCAGGTGCCGGGTCGAAACTGGTCCATGCT
GCCTACTGGTATCTGCCGGGGAGTTTCCTCGGGCTGAAAGCCACGCCGCCCTCCCACTGCCGCCTGCTCG
CGGGCTGA
 Primer design