SecReT4
Protein ID: 85373469
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03210
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]677920..678561 [+]
Producthypothetical protein
Component typeVirB1
UniProt IDQ2NC57
KEGG IDeli:ELI_03210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 213 a.a.     [Download]
>gi|85373469|ref|YP_457531.1| hypothetical protein ELI_03210 [Erythrobacter litoralis HTCC2594]
MEGSMILVRSGRLAFFAMLASISAPAWADVMEIGDDGARWVAGGVAAAPGSTELSAGYAIVPESVAGLPV
TVTTDPRLTARGVPVAYQAKVQELSHRFDLSPSLIEALVWQESRWREKAVSHAGARGLAQLMPGTARYLG
VDPDDPFANLEGGARYLREQLDRFDGDLEKALAAYNAGPGRVLAARGIPNIRETKHYVAAIMGRLSNHSR
KDQ
 
Nucleotide Sequence: 642 bp     [Download]
>gi|85372828|ref|NC_007722.1|:677920-678561 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGAGGGCTCGATGATTCTCGTGAGATCGGGCCGGCTTGCCTTTTTTGCTATGCTGGCTTCGATATCCG
CTCCTGCATGGGCGGACGTCATGGAAATTGGTGACGATGGTGCGCGCTGGGTTGCCGGCGGCGTTGCGGC
TGCCCCTGGCTCGACCGAATTGTCCGCCGGATATGCAATCGTGCCCGAAAGTGTCGCGGGCCTGCCTGTG
ACGGTAACGACCGATCCGCGACTGACTGCGCGCGGTGTGCCGGTGGCGTATCAGGCCAAGGTGCAGGAAC
TCTCTCACCGGTTCGACCTCAGCCCGAGCCTGATCGAAGCGTTGGTCTGGCAGGAAAGCCGCTGGCGCGA
AAAGGCTGTCTCGCATGCCGGCGCGCGGGGGCTGGCGCAATTGATGCCCGGCACCGCGCGCTATCTCGGC
GTCGATCCGGACGATCCCTTTGCCAATCTCGAAGGCGGTGCCCGCTATCTGCGCGAACAGCTCGACCGTT
TCGACGGCGACCTGGAAAAGGCATTGGCCGCCTACAACGCGGGGCCGGGCCGAGTGCTCGCAGCGCGCGG
CATTCCGAACATTCGCGAAACGAAACATTACGTGGCGGCCATCATGGGGCGCCTCTCCAATCATTCCCGG
AAGGATCAATAA
 Primer design