SecReT4
Protein ID: 85373470
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03215
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]678565..678870 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ2NC56
KEGG IDeli:ELI_03215
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-17, Aligned region: 3..96
Protein Sequence: 101 a.a.     [Download]
>gi|85373470|ref|YP_457532.1| hypothetical protein ELI_03215 [Erythrobacter litoralis HTCC2594]
MGSLSRLAALAALVTPTALLAQTQQAADPAGSGPIVNALAWMQSTLLGSVATAVAVMAVAAVGFMMLTGR
INWRFGATVIIGVFILFGATTIVAGIQSAAG
 
Nucleotide Sequence: 306 bp     [Download]
>gi|85372828|ref|NC_007722.1|:678565-678870 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGGTTCGCTTTCCCGCCTCGCCGCGCTTGCGGCACTGGTGACACCGACGGCGCTTCTTGCCCAGACCC
AGCAGGCTGCCGACCCTGCGGGCTCGGGACCGATTGTCAACGCGCTGGCCTGGATGCAGAGCACGCTGCT
CGGCTCGGTCGCGACCGCCGTCGCGGTCATGGCCGTCGCCGCCGTCGGCTTCATGATGCTGACCGGGCGG
ATCAACTGGCGCTTCGGCGCGACGGTGATCATCGGCGTCTTCATCCTGTTCGGCGCGACCACGATTGTCG
CCGGTATCCAAAGCGCGGCAGGCTAG
 Primer design