SecReT4
Protein ID: 85373471
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03220
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]678878..679162 [+]
Producttype IV secretion system protein B3
Component typeVirB3
UniProt IDQ2NC55
KEGG IDeli:ELI_03220
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1e-16, Aligned region: 1..88
Protein Sequence: 94 a.a.     [Download]
>gi|85373471|ref|YP_457533.1| type IV secretion system protein B3 [Erythrobacter litoralis HTCC2594]
MTDLVRHPVHRALTRPQMFAGVTMNFFIINLMVTTIAFLILKSFWIIPVPIITHAIGYFVSLREPRVFDL
WITKVSMCPRVKNYKTWGCNSYAP
 
Nucleotide Sequence: 285 bp     [Download]
>gi|85372828|ref|NC_007722.1|:678878-679162 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGACCGATCTCGTCCGCCATCCCGTCCATCGCGCACTCACCCGGCCGCAAATGTTTGCCGGGGTGACGA
TGAACTTCTTCATCATCAACCTGATGGTGACGACGATCGCCTTCCTGATCCTCAAGAGCTTCTGGATCAT
TCCCGTCCCGATCATCACCCATGCGATCGGATATTTCGTGAGCCTGCGCGAACCGCGCGTTTTCGACCTC
TGGATCACCAAGGTCTCGATGTGTCCGCGGGTGAAGAATTACAAGACGTGGGGGTGCAACAGCTATGCGC
CCTGA
 Primer design