SecReT4
Protein ID: 85373472
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03225
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]679193..681631 [+]
Producttype IV secretion system protein B4
Component typeVirB4
UniProt IDQ2NC54
KEGG IDeli:ELI_03225
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.1e-44, Aligned region: 180..385
AAA_10 [PF12846], Evalue: 6.7e-36, Aligned region: 439..714
Protein Sequence: 812 a.a.     [Download]
>gi|85373472|ref|YP_457534.1| type IV secretion system protein B4 [Erythrobacter litoralis HTCC2594]
MSKWIGPAAMSAKEASAGDRLPYARLVDANTLQLRDGSLMMAIQVPGLLFETEDSDALNAHAATREVVLR
STLDSRFVLYHHVIRRRVAVELDAEFPDPLSRHIDARWKERLGSGSLFINDQFVTLVRRPARGKAGLADR
ASRWFSRRKEELEADPRELRSLQAAATGLIASLQAYGASLLGEYQGPSGGTNSEILELLSALYNGEMKPV
RRPAEDVDIGQMLPYRRASFGLDAMEQRGAGDPDFSAILSLKDYPEATSPGLLDSLLRLPYEMIVTETYA
PQERTTARERIDLSLRRLRSVDEEATAERADMQNARDALGNGAVGFGDHHLSVLVRETTLPRLDDASAAC
AAALADTGAVVVREDTNLEPAFWAQLPGNEAYIVRRAMISSANMASFGSLHGFALGQAAGNHWGDAVTLL
ETTSATPFFFNFHNGDLGNFSVIGPSGSGKTVVMNFLAAQAQKFAPRTILFDKDRGAELFVRGIGGRYDR
IYAGEPTGFNPLALPDSAANRAFLRDWLGVLLKAEGPEELQTIAHAVDAAYENDASLRQLRNFRELLSGS
RRPEPGDLPDRLSAWIHSGEHAWLFDNQRDELDLDNRTLGFDMTALLENPKLRTPTMMYLFHRIEERLDG
NPAMILIDEGWKALDDEVFAARIRDWLKTLRKRNALVGFATQSAADALESRISTALVEQTATMVFMPNSR
ARAEDYCDGFGLTSHELALIRSLPAHSRCFLVRQPDASVVVRLDLSNAPEVLTVLSGRESSVRRLDLLRE
AVGDNPADWFPALTGHAWPGDPSEETEAGADVTAISFKQAAE
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|85372828|ref|NC_007722.1|:679193-681631 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGCAAGTGGATCGGCCCCGCCGCGATGAGCGCGAAGGAAGCCAGCGCCGGCGACCGCCTTCCTTATG
CGCGCTTGGTCGACGCAAACACACTGCAATTGCGCGATGGCTCGCTCATGATGGCGATCCAGGTGCCGGG
CCTGCTGTTCGAGACCGAGGACAGCGACGCGCTCAACGCCCATGCGGCGACGCGCGAAGTCGTGCTGCGC
TCGACACTGGATTCGCGCTTCGTGCTCTATCACCACGTCATTCGCCGCAGGGTCGCGGTGGAGCTGGATG
CCGAGTTTCCCGACCCGCTAAGCCGCCACATCGATGCGCGGTGGAAGGAACGGCTGGGGTCCGGCTCGCT
GTTTATCAACGACCAGTTTGTAACCCTCGTGCGCCGTCCCGCGCGTGGCAAGGCCGGCCTTGCCGACCGC
GCGAGCCGATGGTTCAGCCGCCGCAAGGAAGAGCTTGAGGCCGATCCGCGCGAACTGCGCTCGCTGCAGG
CTGCCGCAACCGGGTTGATCGCCTCGCTGCAAGCCTATGGTGCGAGCCTGCTGGGGGAATATCAGGGGCC
TTCCGGCGGCACCAACAGCGAGATATTGGAGCTCCTTTCCGCGCTCTACAATGGCGAGATGAAGCCGGTG
CGCCGCCCTGCCGAGGACGTCGATATCGGCCAAATGCTGCCCTATCGCCGCGCCAGTTTCGGACTCGACG
CGATGGAGCAGCGCGGGGCGGGCGATCCCGATTTCTCCGCCATCCTCAGCCTCAAGGATTATCCCGAAGC
GACCAGCCCCGGCCTGCTCGATAGCCTGCTGCGCCTGCCTTACGAGATGATCGTGACGGAGACCTATGCA
CCGCAAGAGCGGACCACCGCGCGCGAGCGGATCGACCTGTCGCTGCGGCGCCTGCGCTCGGTCGACGAGG
AAGCCACCGCCGAACGCGCCGACATGCAGAACGCGCGCGATGCGCTGGGCAATGGCGCGGTCGGGTTCGG
CGATCATCACCTAAGCGTGCTGGTGCGCGAGACCACGCTTCCCCGGCTCGACGATGCCAGCGCCGCCTGT
GCCGCTGCGCTGGCCGATACCGGCGCGGTGGTGGTGCGCGAAGACACCAATCTCGAACCGGCCTTCTGGG
CGCAATTGCCCGGCAATGAAGCCTATATCGTGCGCCGCGCGATGATCAGTTCGGCCAATATGGCGAGCTT
CGGTTCGTTGCATGGGTTTGCGCTGGGGCAGGCGGCGGGCAACCATTGGGGCGATGCCGTCACGCTGCTG
GAAACGACCAGCGCGACGCCGTTCTTCTTCAACTTCCACAATGGCGACCTGGGCAATTTCTCCGTCATCG
GGCCGAGCGGTTCGGGCAAGACGGTGGTGATGAATTTCCTCGCCGCGCAGGCGCAGAAATTCGCACCGCG
CACAATCCTGTTCGACAAGGATCGCGGCGCGGAACTGTTCGTGCGCGGGATCGGCGGGCGGTACGACCGG
ATTTATGCCGGAGAGCCGACCGGGTTCAATCCGCTCGCTTTGCCCGATAGCGCCGCCAACCGCGCTTTCC
TGCGCGACTGGCTCGGCGTGCTACTGAAAGCCGAGGGGCCGGAAGAATTGCAGACGATCGCCCACGCGGT
CGACGCCGCCTACGAGAACGATGCCAGCCTGCGCCAACTGCGCAATTTCCGCGAGTTGCTGTCGGGGTCG
CGGCGTCCGGAGCCGGGGGACCTGCCGGATCGCCTGTCGGCCTGGATCCACTCGGGCGAGCATGCATGGC
TGTTCGACAACCAGCGCGACGAGCTCGACCTCGACAATCGAACGCTCGGCTTCGACATGACGGCGCTGCT
GGAAAATCCCAAGCTGCGCACGCCGACCATGATGTACCTGTTCCATCGCATCGAGGAACGGCTCGACGGC
AACCCGGCGATGATCCTTATCGACGAGGGCTGGAAGGCGCTCGACGATGAAGTTTTCGCCGCGCGCATCC
GCGACTGGCTCAAGACGCTGCGGAAGCGCAACGCGCTGGTCGGTTTTGCCACGCAGAGCGCTGCCGACGC
GCTGGAAAGCCGCATCTCGACTGCGCTGGTCGAGCAGACCGCCACCATGGTCTTCATGCCCAACAGCCGC
GCCCGGGCGGAGGATTATTGCGACGGCTTCGGCCTTACCAGTCACGAACTGGCGCTGATCCGCTCGCTGC
CCGCACATAGCCGCTGCTTCCTCGTGCGCCAGCCCGATGCCAGCGTGGTGGTACGACTCGACCTGTCGAA
TGCGCCCGAGGTGCTGACTGTCCTCTCGGGCCGTGAAAGCAGCGTGCGCCGCCTCGATCTGCTGCGCGAA
GCGGTCGGGGACAATCCCGCCGACTGGTTCCCCGCACTTACCGGCCATGCCTGGCCGGGTGACCCCTCGG
AAGAAACCGAAGCGGGCGCGGACGTCACCGCCATTTCCTTCAAGCAGGCTGCCGAATGA
 Primer design