SecReT4
Protein ID: 85373473
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03230
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]681628..682803 [+]
Producthypothetical protein
Component typeVirB6
UniProt IDQ2NC53
KEGG IDeli:ELI_03230
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.5e-38, Aligned region: 53..270
Protein Sequence: 391 a.a.     [Download]
>gi|85373473|ref|YP_457535.1| hypothetical protein ELI_03230 [Erythrobacter litoralis HTCC2594]
MSAQCDLVLSQAAGGIAAALQAVDCVAAEVTGTAFGRLFAPGGALGTVLTILLTLYVAFFAFALITGRSN
LSIRSLTPRMLTVGLVLTFATSWVAYQSVVWNLALGAPDWLAGVLTGDSGSATMTFASKVDIVFLAVEQA
SAGQTDIEAFSPPGMLWMGALLFMLGTVGVLVTARIGLALPVALGPIFVVMALFNGTRGLFTGWLKGVVM
LAMTPLFAVLAGSVMLELSVPILSALTANPGEIPARPAMAFLMVGAVHVALMVMVLKVAGTMVAGWRVFG
MADKTEERSENAAARQSAQSVTVQGDQAAQAANTTAAAASARRTAVAASIPAVAANDSGGSAGPTTVRET
RVVAAASGAGQATPASDPTARTRGLGTRFKSAPPRSMEKMK
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|85372828|ref|NC_007722.1|:681628-682803 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGCGCGCAGTGCGATCTTGTCCTGTCGCAGGCGGCGGGCGGGATTGCCGCCGCGCTGCAGGCGGTCG
ATTGCGTTGCTGCCGAAGTGACCGGCACCGCCTTCGGGCGTCTGTTCGCCCCGGGCGGCGCGCTCGGCAC
GGTGCTGACGATCCTGCTGACGCTCTATGTCGCCTTTTTCGCCTTCGCGCTCATCACGGGCCGGTCGAAC
CTCTCGATCCGCTCGCTGACGCCGCGCATGCTGACGGTCGGCTTGGTGCTGACTTTCGCGACCAGCTGGG
TCGCATACCAGAGCGTGGTCTGGAACCTGGCGCTCGGCGCACCGGACTGGCTGGCAGGCGTGCTGACCGG
CGACAGCGGTTCGGCCACGATGACCTTCGCCAGCAAGGTCGACATCGTTTTCCTCGCGGTCGAACAGGCT
TCGGCCGGACAGACCGACATCGAAGCGTTCTCGCCGCCCGGCATGCTGTGGATGGGCGCGCTGCTGTTCA
TGCTCGGCACCGTCGGTGTGCTGGTGACGGCACGGATCGGGCTGGCGCTGCCGGTCGCGCTGGGGCCGAT
CTTCGTAGTGATGGCGCTGTTCAACGGCACGCGCGGTCTGTTCACCGGCTGGCTCAAGGGCGTGGTCATG
CTGGCGATGACGCCGCTCTTCGCGGTGCTGGCGGGCAGCGTGATGCTGGAATTGTCGGTCCCGATCCTGT
CGGCGCTCACCGCCAATCCCGGCGAAATCCCTGCGCGCCCCGCCATGGCCTTCCTGATGGTCGGTGCGGT
GCATGTCGCGTTGATGGTGATGGTCCTGAAGGTCGCAGGGACGATGGTCGCCGGCTGGCGAGTTTTCGGC
ATGGCCGACAAAACCGAAGAGCGCAGCGAAAACGCTGCCGCACGCCAGTCCGCGCAGAGTGTCACGGTAC
AGGGCGATCAGGCGGCACAGGCCGCCAATACGACGGCTGCCGCCGCCAGTGCACGCCGGACTGCGGTTGC
CGCTTCGATCCCGGCCGTTGCTGCGAACGACAGCGGCGGCTCTGCCGGTCCGACCACGGTACGCGAAACG
CGCGTCGTCGCTGCCGCTTCAGGTGCCGGTCAGGCAACCCCCGCTAGCGACCCCACCGCGCGCACTCGCG
GGCTTGGCACACGTTTCAAGTCCGCGCCGCCGCGATCAATGGAGAAAATGAAATGA
 Primer design