SecReT4
Protein ID: 85373474
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03235
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]682800..683573 [+]
Producttype IV secretion system protein B9
Component typeVirB9
UniProt IDQ2NC52
KEGG IDeli:ELI_03235
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.8e-60, Aligned region: 22..239
Protein Sequence: 257 a.a.     [Download]
>gi|85373474|ref|YP_457536.1| type IV secretion system protein B9 [Erythrobacter litoralis HTCC2594]
MIRAGLPALSLVLMATPLAAQDSRLVEVLYDPSRVVTIEGRTKVQATIKFGDNESIENVAIGDSTAWQVT
PNKRANLLFVKPLEATAKTNMTVVTNKHTYLFDLIASPRANPLYVLSFTYPEEPEDEQDAQLAATGEANP
LEVAAATDPYAVIDPATLNWSWAKDGDPALFPLRAFDDGEATFLEWDTRTPVPAILVKNVEGEEGPVNFT
VRGNTIVVDGVPREIILRSGDEVATLVNTGPVGKPASPQQAQLAGGR
 
Nucleotide Sequence: 774 bp     [Download]
>gi|85372828|ref|NC_007722.1|:682800-683573 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGATCCGCGCAGGTCTTCCCGCGCTCTCACTCGTGCTGATGGCGACACCGCTTGCGGCCCAGGATTCAC
GCCTGGTCGAGGTACTCTACGATCCGTCCCGCGTGGTCACCATCGAGGGCCGCACCAAGGTGCAAGCGAC
AATCAAGTTCGGCGACAACGAGTCGATCGAAAACGTCGCGATCGGCGACAGCACTGCGTGGCAGGTCACG
CCCAACAAGCGCGCCAACCTGCTGTTCGTGAAACCGCTCGAAGCTACCGCCAAGACCAATATGACGGTGG
TCACCAACAAGCACACCTACCTGTTCGACCTGATCGCGAGCCCGCGCGCCAATCCGCTCTATGTCCTGAG
CTTCACCTATCCGGAGGAGCCGGAGGACGAGCAGGACGCGCAACTCGCGGCGACCGGAGAGGCCAACCCG
CTGGAAGTGGCGGCGGCGACCGATCCCTATGCCGTGATCGACCCGGCGACCCTCAACTGGTCATGGGCCA
AGGATGGCGACCCTGCGCTGTTTCCGCTGCGCGCGTTCGACGATGGCGAAGCGACCTTCCTCGAATGGGA
TACGAGGACCCCCGTTCCGGCAATACTGGTCAAGAATGTCGAAGGTGAAGAGGGCCCGGTCAATTTTACC
GTGCGGGGCAACACCATCGTGGTCGACGGTGTCCCGCGCGAGATCATTCTGCGGTCGGGCGATGAAGTCG
CGACTCTCGTCAACACCGGGCCGGTCGGCAAACCGGCCTCGCCCCAGCAAGCCCAGCTTGCCGGCGGGCG
CTGA
 Primer design