SecReT4
Protein ID: 85373475
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03240
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]683605..684711 [+]
Producttype IV secretion system protein B10
Component typeVirB10
UniProt IDQ2NC51
KEGG IDeli:ELI_03240
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3e-53, Aligned region: 196..364
Protein Sequence: 368 a.a.     [Download]
>gi|85373475|ref|YP_457537.1| type IV secretion system protein B10 [Erythrobacter litoralis HTCC2594]
MRLPDKDSGSFGANDVDPRETQDADVTDLASRTSYPAVANKGGKSDAMGLVAGIAIVAALGAVTFWSMNA
AQVPPPEGVGSAQVEQAPVQAQAPQQAVAPAPVAAPRPDPAPAPVYAQSPDAVTVPRANPNASPSLVFDA
SARAAGPEAAVAPGTASALPGGGNASGNSANDFASRVGGVGGGPAQAARMVNPATTVTQGTLIPAILETA
IDTDVPGFVRAVVSQDVRSFDGKNVLVPRSSRLVGQYQSGVQGGQKRAYVIWTRLIRPDGVSVPLQSPAI
GFDGTTGLRGDVNSRFFQRFGSAMLLSVVGGLGAIASGGASVVIGGAGQSAAAAAVQQDSQVGPVIRVRQ
GEPIRVFTARDLDFSTVM
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|85372828|ref|NC_007722.1|:683605-684711 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGCGACTTCCGGACAAGGACAGCGGCAGCTTCGGCGCCAACGACGTCGACCCGCGCGAGACCCAGGATG
CGGATGTCACCGATCTCGCCAGCCGGACAAGCTATCCCGCCGTTGCCAACAAGGGCGGCAAGTCGGATGC
GATGGGGCTGGTGGCCGGCATCGCCATCGTCGCTGCGCTCGGCGCGGTCACATTCTGGAGCATGAACGCC
GCGCAGGTGCCGCCGCCCGAAGGCGTGGGCAGCGCGCAGGTAGAGCAGGCTCCGGTCCAGGCGCAGGCCC
CGCAGCAGGCGGTCGCGCCGGCACCTGTCGCCGCGCCGCGACCCGATCCGGCACCTGCCCCGGTCTATGC
GCAGAGTCCCGATGCCGTGACCGTTCCGCGCGCCAATCCCAACGCGAGCCCGTCGCTGGTGTTCGATGCC
AGCGCCCGCGCGGCAGGGCCCGAAGCCGCGGTTGCGCCCGGAACGGCGTCGGCCTTGCCGGGGGGCGGCA
ACGCGAGCGGCAATTCGGCCAACGATTTCGCCAGTCGCGTAGGAGGCGTGGGCGGCGGCCCGGCGCAGGC
CGCGCGGATGGTCAACCCGGCGACCACGGTGACCCAGGGCACGCTGATCCCGGCCATTCTCGAAACCGCC
ATCGACACCGATGTGCCGGGCTTCGTGCGTGCCGTGGTGAGCCAGGATGTCCGTAGTTTCGACGGCAAGA
ACGTGCTCGTCCCCCGTTCCAGCCGCCTGGTCGGTCAATATCAGTCGGGCGTGCAGGGCGGGCAGAAGCG
CGCCTATGTTATCTGGACCCGCCTGATCCGGCCCGACGGTGTGTCCGTACCGCTGCAGTCGCCGGCCATC
GGTTTCGATGGCACCACCGGCCTCAGGGGCGACGTGAACAGTCGCTTCTTCCAGCGTTTCGGTTCGGCCA
TGCTGCTCTCGGTCGTCGGCGGCCTTGGCGCTATCGCCAGTGGCGGGGCGTCGGTCGTTATCGGCGGGGC
CGGGCAATCGGCCGCCGCGGCAGCCGTGCAGCAGGACAGTCAGGTCGGCCCGGTCATCCGGGTCCGCCAA
GGTGAACCGATCCGCGTGTTCACTGCCCGCGATCTCGATTTCTCGACGGTGATGTAG
 Primer design