SecReT4
Protein ID: 85373476
T4SS name [ID]VirB [430]
Gene symbol-
Locus tagELI_03245
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]684727..685740 [+]
Producttype IV secretion system protein B11
Component typeVirB11
UniProt IDQ2NC50
KEGG IDeli:ELI_03245
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.9e-77, Aligned region: 32..319
Protein Sequence: 337 a.a.     [Download]
>gi|85373476|ref|YP_457538.1| type IV secretion system protein B11 [Erythrobacter litoralis HTCC2594]
MSADVHPFAKQAEAAETPLPGDRSVYLEAYLKPFREWLDRDTVTEILVNRPGEVWIEDAASPGMQRVDTP
HIDDRLVQRLAEQVARVSHQGINREHPLLGATLPDGARVQFCGPPASRKHWCMAIRRHRRLDLPLDAYDS
GPLSPPQEQAMPDAQAEPIAFLREAIRQRRTILISGGTSTGKTTFLNAMLGEIPKEQRVVLVEDTPELRL
PGENGVGLVAVKGELGEAKVTANELLQAALRLRPDRIVLGELRGAESVSFLRAINTGHPGSFSTIHANSI
TGALEQLSLMVMQTGIGLSRSDTIAYASNVIDVIVQLGRSGEGKRGISEIALAKDLV
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|85372828|ref|NC_007722.1|:684727-685740 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGCGCGGACGTCCATCCCTTTGCGAAACAGGCCGAAGCGGCGGAAACCCCGCTGCCGGGCGATCGCA
GCGTCTATCTCGAGGCCTATCTCAAGCCGTTCCGCGAATGGCTCGACCGCGACACGGTGACGGAAATACT
CGTCAACCGCCCTGGCGAAGTCTGGATCGAGGATGCAGCCTCGCCAGGCATGCAACGCGTCGATACGCCG
CATATCGATGACCGGCTGGTCCAGCGCCTCGCCGAACAGGTCGCGCGGGTCAGCCATCAGGGCATCAACC
GCGAGCATCCCCTGCTGGGCGCGACATTGCCCGACGGGGCGCGGGTGCAGTTCTGCGGACCGCCTGCCAG
CCGCAAGCATTGGTGCATGGCGATCCGTCGCCACCGGCGCCTGGACCTGCCGCTCGACGCTTACGACTCC
GGGCCGCTCTCACCGCCGCAGGAACAGGCCATGCCCGATGCGCAGGCCGAGCCGATCGCGTTTCTGCGCG
AAGCCATCCGGCAGCGGCGCACGATCCTGATTTCGGGCGGTACGAGCACCGGCAAGACGACGTTCCTCAA
CGCCATGCTGGGCGAAATTCCCAAAGAGCAGCGGGTCGTTCTGGTCGAGGATACGCCCGAACTGCGTTTG
CCGGGCGAGAACGGCGTCGGTCTCGTCGCAGTCAAGGGCGAGCTTGGCGAGGCGAAGGTCACGGCCAATG
AACTGCTGCAGGCGGCGCTGCGCTTGCGCCCCGACCGCATCGTGCTGGGCGAATTGCGCGGCGCCGAAAG
CGTCAGCTTCCTGCGCGCTATCAATACCGGCCACCCGGGCAGTTTCTCGACCATCCACGCCAACTCGATC
ACCGGCGCGCTCGAGCAATTGTCGCTGATGGTCATGCAGACCGGCATCGGTCTTAGCCGCAGCGACACGA
TCGCTTATGCCTCCAACGTGATCGACGTCATCGTCCAGCTCGGCCGCAGCGGGGAGGGCAAGCGCGGGAT
AAGCGAAATCGCGCTCGCCAAGGACCTCGTCTAG
 Primer design