SecReT4
Protein ID: 85373686
T4SS name [ID]Tra_F [545]
Gene symbol-
Locus tagELI_04295
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]890632..891444 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ2NBJ0
KEGG IDeli:ELI_04295
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7.4e-67, Aligned region: 47..259
Protein Sequence: 270 a.a.     [Download]
>gi|85373686|ref|YP_457748.1| hypothetical protein ELI_04295 [Erythrobacter litoralis HTCC2594]
MTHLHHLTALALGIAALPATLAQAQERRDTRSTTSADALYCEERRLGYWFYCVKPAPIEEPQQPEAEQVA
ASQELDAITSELRELKARAILYPTEANVAAYIRFQRAQLDRASLFSDVWQRAIWQDPDLDYTLERPVGAV
AKKQWQDARSAERDHVMATLSQRYGLFYFFSSTCGPCEVMSPIVKGVADRWRITVRAISTDGGSSRHFPD
YRVETNQRGKLGLEGKATPALVLWDSVTKRPIPIGYGVLSADELQDRIYLLTSKEAGHDY
 
Nucleotide Sequence: 813 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c891444-890632 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGACCCATCTGCATCACCTCACGGCGCTCGCGCTCGGCATCGCTGCCCTGCCCGCCACTCTGGCCCAGG
CGCAGGAGCGGCGGGACACAAGATCGACCACCTCGGCAGACGCGCTCTACTGCGAAGAGCGCAGGCTCGG
CTACTGGTTCTACTGCGTGAAGCCCGCTCCCATTGAAGAGCCACAACAGCCTGAAGCCGAGCAGGTCGCG
GCCAGCCAAGAACTCGACGCGATCACCTCCGAGCTTCGCGAACTCAAGGCGCGCGCGATCCTCTATCCGA
CCGAGGCCAATGTCGCGGCCTATATCCGCTTCCAGCGCGCGCAGCTCGACCGCGCCTCGCTGTTCTCCGA
TGTCTGGCAGCGGGCGATCTGGCAGGACCCGGACCTCGACTACACGCTTGAACGCCCCGTCGGAGCGGTC
GCCAAGAAGCAGTGGCAGGATGCCCGCAGCGCGGAGCGCGATCACGTCATGGCAACGCTCTCGCAGCGCT
ACGGCCTTTTCTATTTCTTCAGTTCGACCTGCGGACCGTGCGAAGTGATGAGCCCGATCGTGAAGGGCGT
CGCCGACCGATGGCGGATCACCGTGCGCGCGATCTCCACCGATGGCGGTTCATCCCGGCATTTTCCCGAC
TATCGGGTCGAGACGAACCAGCGCGGCAAGCTTGGTCTCGAAGGCAAAGCCACCCCCGCTCTGGTGCTGT
GGGACAGCGTGACCAAACGCCCGATTCCGATCGGCTACGGCGTGCTCTCGGCCGACGAGCTGCAGGACCG
CATCTACCTTCTCACCTCCAAGGAAGCCGGACATGATTACTAG
 Primer design