SecReT4
Protein ID: 85373700
T4SS name [ID]Tra_F [545]
Gene symbol-
Locus tagELI_04365
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]903452..903739 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ2NBH6
KEGG IDeli:ELI_04365
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 6.3e-31, Aligned region: 3..94
Protein Sequence: 95 a.a.     [Download]
>gi|85373700|ref|YP_457762.1| hypothetical protein ELI_04365 [Erythrobacter litoralis HTCC2594]
MADRYLVPRRLDDPELIGFWTIDEFAGLLVPFAWGILAQHIIIGTGLSVMTWFALRKAKASGAGSKLVHA
AYWYLPGSFLGLKATPPSHCRLLAG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c903739-903452 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGCCGACAGATACCTCGTTCCACGGCGGCTCGACGATCCGGAGCTCATCGGTTTCTGGACCATCGACG
AGTTTGCGGGACTGCTCGTCCCGTTCGCCTGGGGCATCCTTGCGCAGCACATCATCATCGGCACCGGCCT
ATCGGTCATGACTTGGTTCGCCCTTCGAAAGGCCAAAGCTTCAGGTGCAGGGTCGAAACTGGTGCATGCT
GCCTACTGGTATCTGCCGGGGAGCTTCCTCGGGCTGAAAGCCACGCCGCCCTCCCACTGTCGCCTGCTCG
CAGGCTGA
 Primer design