SecReT4
Protein ID: 85375784
T4SS name [ID]Tra_F [546]
Gene symbol-
Locus tagELI_14785
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]2985117..2985932 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ2N5J2
KEGG IDeli:ELI_14785
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.9e-68, Aligned region: 47..260
Protein Sequence: 271 a.a.     [Download]
>gi|85375784|ref|YP_459846.1| hypothetical protein ELI_14785 [Erythrobacter litoralis HTCC2594]
MMRRQLIVALTLWLATVIPAPATAQQSRTAEATTRADSLYCEQRRLGYWFYCVKPVPVAEPEKEQPAKEV
AATQQLDAITEELRELKARAILYPTPENVTAYIRFQRAQLDRASLFSDVWQRAIWQDPELDYTLERPVGA
LAKKQWQDARAADRDAVMARLSERYGLFYFFAQTCGACEVMSPIVRSVADRWQITVRAISTDGGPSRHFP
DYKVESGQRPRMGLEPGITPALVLWDSLAKRPIPIGYGVLSADELQDRIYLLTVKEAGHDY
 
Nucleotide Sequence: 816 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c2985932-2985117 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGATGCGCCGCCAATTGATCGTCGCCCTGACCTTGTGGCTCGCCACTGTAATACCCGCCCCGGCAACCG
CGCAGCAAAGCCGGACGGCAGAGGCGACCACGAGAGCTGACAGCCTCTATTGCGAGCAGCGCCGGCTCGG
TTACTGGTTCTATTGCGTCAAGCCGGTCCCGGTAGCCGAACCCGAAAAGGAGCAGCCTGCAAAAGAGGTT
GCAGCTACGCAGCAGCTCGACGCGATCACCGAAGAATTGCGCGAGCTCAAAGCCCGCGCGATCCTCTATC
CGACACCGGAGAACGTCACCGCCTACATCCGTTTTCAGCGCGCACAGCTCGACCGGGCTTCGCTGTTCTC
CGATGTCTGGCAGCGCGCCATCTGGCAGGATCCCGAACTCGACTACACGCTTGAGCGCCCGGTCGGCGCG
CTTGCCAAGAAGCAATGGCAGGATGCGCGCGCTGCCGACCGCGACGCGGTGATGGCGCGGCTGTCTGAGC
GCTACGGCCTGTTCTATTTCTTTGCCCAGACCTGCGGGGCCTGCGAGGTCATGAGCCCGATCGTCAGATC
AGTGGCGGACCGTTGGCAGATTACGGTGCGGGCGATCTCGACCGACGGCGGACCCTCGCGGCACTTCCCT
GACTACAAGGTCGAAAGCGGCCAGCGCCCGCGCATGGGGCTCGAGCCCGGGATTACGCCTGCGCTGGTGC
TTTGGGACAGCCTCGCCAAGCGCCCGATCCCGATCGGATACGGCGTGCTCTCGGCCGACGAGCTCCAGGA
CCGCATCTACCTCCTCACCGTGAAAGAAGCCGGACATGATTACTAG
 Primer design