SecReT4
Protein ID: 85375798
T4SS name [ID]Tra_F [546]
Gene symbol-
Locus tagELI_14855
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]2998000..2998287 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ2N5H8
KEGG IDeli:ELI_14855
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.9e-32, Aligned region: 3..94
Protein Sequence: 95 a.a.     [Download]
>gi|85375798|ref|YP_459860.1| hypothetical protein ELI_14855 [Erythrobacter litoralis HTCC2594]
MADRYLVPRRLDDPELIGFWTIDEFAGILIPFAWGILAQHIFIGIGLAAGAWLALRKAKARGAGSALVHA
AYWYLPGSFLGLKATPPSHCRLLAG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c2998287-2998000 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGCCGACAGGTATCTTGTTCCACGGCGGCTCGACGATCCGGAGCTAATCGGCTTCTGGACCATCGACG
AGTTTGCAGGGATTCTCATCCCCTTCGCCTGGGGCATTCTCGCGCAGCACATTTTCATCGGTATCGGCCT
GGCCGCCGGAGCCTGGCTTGCCTTGCGGAAGGCAAAGGCTCGCGGTGCCGGATCGGCGCTGGTGCACGCT
GCGTACTGGTATCTGCCCGGGAGTTTCCTGGGGCTGAAAGCCACGCCGCCCTCCCATTGCCGCCTGCTGG
CGGGCTGA
 Primer design