SecReT4
Protein ID: 85859518
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01860
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1740702..1741010 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ2LTZ5
KEGG IDsat:SYN_01860
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.1e-08, Aligned region: 18..85
Protein Sequence: 102 a.a.     [Download]
>gi|85859518|ref|YP_461720.1| hypothetical protein SYN_01860 [Syntrophus aciditrophicus SB]
MSRPWVASFSRSEAMTKRFPQYLSAPLQVLWFEPDELGVVFTCFLFALIYGSFSWALLFIAPWQYSRAKK
RYPKGFFRHFLYFAGITRMKGYPSFFEERFFE
 
Nucleotide Sequence: 309 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1740702-1741010 Syntrophus aciditrophicus SB chromosome, complete genome
TTGTCCAGACCCTGGGTTGCATCATTTAGCCGGTCTGAAGCGATGACGAAGCGCTTTCCGCAGTATCTCT
CGGCCCCGCTGCAGGTGCTCTGGTTCGAGCCGGACGAGTTGGGGGTCGTCTTCACCTGCTTTCTTTTCGC
CCTGATCTACGGTTCTTTCTCCTGGGCGCTCCTCTTCATCGCGCCCTGGCAATACAGCCGGGCGAAAAAG
AGGTACCCCAAGGGTTTCTTCCGGCATTTTCTCTACTTCGCCGGGATCACCAGAATGAAGGGATACCCGT
CCTTTTTCGAGGAGAGGTTTTTCGAATGA
 Primer design