SecReT4
Protein ID: 85859519
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01861
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1741007..1741591 [+]
Productsex pilus assembly/synthesis protein
Component typeTraE_F
UniProt IDQ2LTZ4
KEGG IDsat:SYN_01861
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.1e-29, Aligned region: 1..182
Protein Sequence: 194 a.a.     [Download]
>gi|85859519|ref|YP_461721.1| sex pilus assembly/synthesis protein [Syntrophus aciditrophicus SB]
MRLNLFLQKTSNIVAENRLLKFVVVVIGVAAIANAVMTYRALNYQRTIIVPPVLKSRIEITGDRVSEEYV
KAFSRYIAALSFSYSPGTVKPQFDELLALYAPEAFPEGKRVLYELADRVITTRVTSVFFMGKLYVDGEKN
QIEVSGQRRQYVDDRKVEDITKTYLIDYRISDGRFQVVRISEKEDANSQAARLP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1741007-1741591 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAGGCTCAATCTTTTTCTGCAGAAGACTTCCAACATCGTCGCGGAGAACAGGCTTCTCAAGTTCGTGG
TCGTGGTGATCGGCGTCGCGGCGATCGCGAACGCGGTCATGACCTACCGCGCGTTGAATTACCAGCGGAC
TATCATCGTCCCCCCGGTCCTGAAAAGCCGGATCGAGATCACGGGGGACAGGGTCTCGGAGGAATACGTG
AAGGCCTTCAGCCGGTATATCGCTGCTCTGTCCTTCAGCTATTCCCCGGGGACCGTGAAACCGCAATTCG
ACGAACTCCTCGCTCTTTATGCGCCGGAAGCGTTTCCGGAGGGAAAGCGGGTCCTTTACGAACTTGCGGA
CAGGGTGATCACCACCCGGGTAACGAGCGTCTTCTTCATGGGAAAGCTGTATGTGGACGGCGAGAAGAAC
CAGATCGAGGTGTCGGGACAAAGAAGGCAGTACGTCGACGACCGCAAGGTGGAGGACATCACGAAGACAT
ACCTCATCGATTACAGGATCTCGGACGGCAGGTTCCAGGTCGTCAGGATATCGGAGAAGGAAGATGCGAA
CAGCCAGGCGGCGAGGTTGCCATGA
 Primer design