SecReT4
Protein ID: 85859520
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01862
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1741588..1742442 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ2LTZ3
KEGG IDsat:SYN_01862
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1e-57, Aligned region: 12..272
Protein Sequence: 284 a.a.     [Download]
>gi|85859520|ref|YP_461722.1| hypothetical protein SYN_01862 [Syntrophus aciditrophicus SB]
MKKNMLKKKVGMLLVLTLAVSVLGSAGIASSQEENVPENRETADVQITKLPAEGAVTVMPEVAQPVELSS
SDVNRITCQGEIKDVVYSREKGITVKFSGRDAFVKFRTGLKDGKSTYSTTPSEIFVVCGDNVYSLIALPK
RIPARSIRLSPGKTENIRKNRSLFGALPFEKKVLSAIRSLYTEEIPESFTVSTPNKRIDLFRDLDIVLAR
VAVVEGEGIQVKEYRGTLAGGDKDRIELGEKDFLRNEISTDPIAVSLDRLVLKKGEILRAFVVESHREEP
GDER
 
Nucleotide Sequence: 855 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1741588-1742442 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAAAAGAACATGCTTAAAAAAAAGGTGGGAATGCTTCTCGTTCTCACGCTGGCCGTTTCCGTCCTCG
GGAGCGCGGGCATCGCATCCAGCCAGGAAGAAAATGTCCCCGAAAACCGTGAAACGGCCGACGTACAGAT
CACTAAACTACCGGCGGAGGGCGCCGTCACCGTCATGCCCGAGGTCGCCCAGCCCGTCGAGCTGAGCAGT
TCGGACGTGAACCGGATCACCTGCCAGGGCGAAATCAAGGACGTCGTCTACTCAAGGGAGAAGGGGATCA
CGGTCAAGTTCAGCGGCAGGGACGCTTTCGTCAAGTTCCGTACGGGCTTGAAGGATGGCAAGAGCACGTA
CAGCACGACGCCGTCGGAGATCTTCGTCGTTTGCGGCGATAACGTTTACAGCCTGATCGCTCTTCCCAAG
AGAATCCCCGCCCGGTCCATCAGGCTCTCCCCGGGAAAAACGGAGAACATCAGGAAGAACAGGTCGCTTT
TCGGCGCCCTCCCTTTTGAGAAGAAGGTCCTCTCCGCGATCCGGAGCCTCTACACGGAAGAGATTCCCGA
GAGCTTCACCGTATCCACCCCCAACAAGAGAATCGATCTCTTTCGTGACCTGGATATCGTCCTTGCCAGG
GTAGCGGTGGTCGAAGGCGAGGGTATCCAGGTTAAGGAGTACCGCGGCACGCTCGCCGGTGGAGACAAGG
ACAGGATCGAGCTCGGCGAAAAGGATTTTCTCCGAAACGAAATCTCCACCGACCCCATCGCCGTCTCCCT
GGACAGGCTTGTCCTGAAAAAGGGGGAGATCCTGAGAGCCTTCGTGGTCGAATCTCACCGGGAGGAACCG
GGCGATGAAAGATAA
 Primer design