SecReT4
Protein ID: 85859521
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01863
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1742432..1743625 [+]
Productpilus assembly protein
Component typeTraB_F
UniProt IDQ2LTZ2
KEGG IDsat:SYN_01863
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.1e-40, Aligned region: 185..385
Protein Sequence: 397 a.a.     [Download]
>gi|85859521|ref|YP_461723.1| pilus assembly protein [Syntrophus aciditrophicus SB]
MKDKLKTIWANVTPRQKRNLVLLAMATVVLAFSLAGYLFKTRDGGTVLGKSAQKKKEITLDAGLLEKSAY
LEGRKEIARTEEKLSLLQKELDEIKEEKAKAVHAGSKQPLPAVPKPPDPSKAISYPVPPLPPPPVSSADP
SKVGQASKPAAETTGDIELVSNPQAQKQDQKAAEVKKNEKGDSVYLPPSFMEATLLSGLDAPTVESAKGN
PVPVLLRIKDLAILPNKVKADLKGCFVIAEGQGNLADERAHLRLVNLSCLSRKGQAVIDQKIKGFVVDSD
GKIGLRGTVVSKMGSAIARSVLAGFFGGVGDALRSATMTSSISALGTTQTVDPGQIAQAGLGSGLAQGAH
ELQKFYLELAKQSMPVIEVGATRNITLVVSEGVDLEIKEKPGGKKQK
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1742432-1743625 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAAGATAAGTTGAAGACCATCTGGGCGAACGTCACACCGCGGCAAAAGCGGAACCTTGTCCTTCTCG
CCATGGCGACGGTGGTACTGGCGTTCAGCCTCGCGGGGTACCTTTTCAAGACGAGAGACGGCGGGACGGT
TTTGGGGAAATCCGCGCAGAAAAAGAAGGAAATCACCCTGGACGCCGGGCTCCTGGAAAAATCCGCCTAC
CTCGAAGGGCGAAAAGAGATCGCCAGGACCGAGGAGAAGCTCTCGCTTCTCCAGAAAGAACTGGACGAAA
TCAAGGAAGAGAAGGCGAAGGCCGTCCACGCAGGATCGAAGCAACCCCTTCCGGCGGTCCCGAAGCCGCC
CGATCCATCAAAGGCGATCTCTTACCCCGTTCCGCCTTTGCCGCCTCCACCCGTTTCCTCGGCCGATCCA
TCCAAGGTCGGGCAGGCGTCCAAGCCCGCCGCGGAGACGACGGGTGATATCGAACTCGTCTCGAATCCAC
AGGCGCAGAAACAGGATCAGAAGGCCGCCGAGGTAAAAAAAAACGAGAAGGGCGACTCGGTCTATCTGCC
CCCTTCTTTCATGGAGGCGACCCTTCTTTCCGGCCTGGACGCCCCGACGGTGGAGTCGGCCAAGGGGAAC
CCCGTCCCGGTTCTCCTGAGGATCAAGGACCTGGCGATCCTCCCCAACAAGGTCAAAGCAGACCTTAAAG
GATGCTTCGTCATCGCCGAAGGACAGGGTAATCTCGCCGACGAGCGGGCGCACCTGAGGCTGGTGAACCT
CTCCTGCTTGTCAAGGAAGGGCCAAGCCGTGATCGACCAGAAGATCAAGGGCTTCGTCGTCGATTCAGAC
GGGAAGATCGGCCTCAGGGGAACGGTGGTCTCCAAGATGGGATCGGCAATCGCGCGGTCCGTCCTTGCCG
GGTTCTTCGGCGGAGTCGGAGACGCCCTACGGTCCGCCACCATGACCTCCAGTATCAGCGCGCTCGGCAC
GACCCAGACCGTGGATCCCGGGCAGATCGCCCAGGCGGGGTTGGGAAGCGGACTCGCCCAGGGGGCGCAC
GAGCTCCAGAAGTTTTATCTGGAACTTGCCAAACAGAGCATGCCCGTGATCGAGGTCGGGGCTACGCGAA
ACATCACCCTTGTCGTGAGCGAGGGGGTCGACTTGGAGATCAAGGAAAAACCAGGAGGGAAGAAGCAGAA
ATGA
 Primer design