SecReT4
Protein ID: 85859522
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01864
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1743622..1744065 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ2LU00
KEGG IDsat:SYN_01864
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.4e-19, Aligned region: 24..135
Protein Sequence: 147 a.a.     [Download]
>gi|85859522|ref|YP_461724.1| hypothetical protein SYN_01864 [Syntrophus aciditrophicus SB]
MKRVLCLLTLTALLGGCSVLNPYKSEFTCPQKENGKCVGVETAYGESLQKKNKDESLEPATKNSPGKAVT
GPAQKVNLLYQEEVYRKLTGLLRDPVTPLVAPPRVMRVLLLPYKGDGGELFMPRYVYFMADDARWIMGGY
LKEGAAD
 
Nucleotide Sequence: 444 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1743622-1744065 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAACGGGTCCTGTGTCTATTAACGTTAACCGCCCTGCTCGGCGGCTGCTCGGTCTTGAATCCATACA
AGAGCGAGTTCACCTGCCCGCAAAAGGAAAACGGCAAGTGCGTAGGCGTGGAGACGGCCTACGGCGAGTC
CCTGCAGAAAAAAAATAAAGACGAAAGCCTTGAGCCTGCAACCAAAAACTCACCGGGCAAAGCGGTGACC
GGTCCGGCACAAAAGGTCAATCTTCTCTATCAGGAGGAAGTCTACCGGAAACTCACCGGGCTCCTCAGGG
ATCCGGTCACGCCGCTCGTCGCGCCTCCCCGGGTCATGAGGGTGCTTCTCCTCCCTTACAAAGGCGATGG
AGGGGAACTCTTCATGCCGAGATACGTCTACTTCATGGCCGACGATGCCCGTTGGATCATGGGCGGCTAC
CTGAAGGAAGGAGCGGCCGACTGA
 Primer design