SecReT4
Protein ID: 85859523
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01865
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1744023..1746557 [+]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDQ2LTZ9
KEGG IDsat:SYN_01865
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.2e-55, Aligned region: 40..262
AAA_10 [PF12846], Evalue: 1.4e-47, Aligned region: 458..759
Protein Sequence: 844 a.a.     [Download]
>gi|85859523|ref|YP_461725.1| sex pilus assembly protein [Syntrophus aciditrophicus SB]
MDHGRLPEGRSGRLMGKLFDVIFGARGGMTRKDLRNLTRRDRFSDYLPWIAYDGETEAYHNADGTKGFLW
ECSPLCFAGEKTLFTLEGLFRLGLPHGSVMQFILHADSHIDPYIEAYRSGKTRDLAIVHEASEKFAAFLE
KGVEGMDIFLKTPLRNFRLFVAVKFPEEREMKLHAKDLSNSILEILRGADLYPRPVPPHALVEWMRRYLN
DVPSPNNDAYDDSIPIRKQVIFSDTVIEKSMDRMKVGNRYFRCTTVKHYPKEVDPLQTNELFGGVWGVVS
DANQITTPFFFALNVVFHNLKSKLHTKCNLVLQQQGVGSFAPSLMRKKDEYMTAVDEVEKGTPFVRVIPI
LWVWGDSEKTVSESIVRAKRMWEAQGYVMQEDRGILPVLFLSSLPFGLYDRDDNVDNLDRDFIAPCDSVA
VTLPVQADFSGGGKPSLIFIGRKGQPCSLDVFDRHANNHNIFIAASSGSGKSFLVNYLVYNYFASSALIR
IVDIGGSYKKMTRLFGARFLDFSEQSRICMNPFTNVMDPAGDLPVIASIVLQMVYSSTDIVPEDTAETAM
SLIKSAVKWAWRTEGADASIDTVYEYLSTFPEHAEEFDSCHENDIAAFRSLSRNLSFNLTEFTSGHLYGK
WFNGTSDFNIAGDEFVVLELEHLKPQKELFKVITLQVINAVTQDLYISDRSRPRFIIFDEAWQFMQEGSS
LKGVIEEGYRRARKYGGSFTVITQSILDLKQFGSIGDVIRSNSAFKFYLESSDFDRAKLEGLIEHEGFAL
KILKSVRSNKPKYSEIFMDTPFGQGVARLAVDPFSYYLYTSDAAEIAEIESLVDNGMSYGEAINEMVKRY
RTAG
 
Nucleotide Sequence: 2535 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1744023-1746557 Syntrophus aciditrophicus SB chromosome, complete genome
TTGGATCATGGGCGGCTACCTGAAGGAAGGAGCGGCCGACTGATGGGAAAGCTCTTTGACGTGATCTTCG
GCGCCCGCGGGGGAATGACCCGCAAGGATCTCCGAAATTTGACCCGCAGAGACCGGTTTTCCGATTATCT
CCCCTGGATCGCTTACGACGGGGAAACGGAAGCATACCACAACGCGGACGGGACCAAGGGCTTTCTCTGG
GAATGCAGCCCATTGTGCTTCGCAGGGGAAAAGACCCTCTTCACCCTGGAGGGGCTCTTCCGGCTGGGGC
TTCCGCACGGATCGGTCATGCAGTTCATCCTGCACGCCGACAGCCACATCGATCCCTACATCGAGGCGTA
CCGGTCGGGGAAAACGCGTGACCTCGCGATCGTTCACGAGGCCTCCGAGAAGTTCGCCGCTTTCCTTGAG
AAGGGCGTGGAGGGCATGGACATCTTCCTCAAAACCCCTCTGAGAAATTTCCGCCTCTTCGTGGCGGTGA
AGTTCCCCGAAGAACGGGAGATGAAGCTCCACGCGAAGGATCTCTCCAACTCCATACTGGAGATCCTGAG
GGGGGCGGACCTCTATCCCAGGCCCGTGCCTCCCCATGCGCTCGTCGAATGGATGCGCAGATACCTAAAC
GACGTTCCTTCCCCGAATAACGACGCCTACGACGATTCGATTCCCATTCGGAAACAGGTGATCTTCTCCG
ATACGGTCATCGAAAAATCCATGGACCGAATGAAGGTAGGGAACCGGTATTTCCGCTGCACCACGGTAAA
ACACTATCCCAAGGAAGTGGACCCGCTCCAGACGAACGAGCTCTTCGGGGGCGTGTGGGGAGTGGTCTCC
GACGCCAACCAGATCACGACGCCGTTTTTCTTCGCGCTGAACGTCGTATTTCACAATCTCAAGTCGAAGC
TCCACACGAAGTGCAACCTCGTTTTGCAGCAGCAGGGGGTTGGAAGCTTCGCCCCTTCCCTCATGAGAAA
GAAAGACGAGTACATGACCGCGGTGGACGAGGTGGAAAAGGGGACCCCTTTCGTGAGGGTGATCCCGATC
CTCTGGGTCTGGGGGGACAGCGAAAAGACCGTGAGTGAATCGATCGTGAGGGCCAAGCGGATGTGGGAAG
CGCAGGGCTACGTCATGCAGGAGGACAGGGGGATCTTGCCCGTCCTCTTTCTCTCGTCCCTTCCCTTCGG
CCTCTATGACCGGGACGACAACGTGGACAACCTCGACCGGGACTTTATCGCGCCCTGTGACAGCGTAGCG
GTGACCCTCCCCGTCCAGGCGGACTTCTCCGGCGGAGGCAAGCCGAGTCTCATCTTCATCGGGAGAAAGG
GGCAGCCCTGTTCCCTGGACGTTTTCGACCGGCACGCCAACAACCATAACATTTTCATCGCAGCCTCTTC
GGGAAGCGGAAAATCCTTCCTCGTGAATTACCTCGTCTACAACTATTTCGCTTCCAGCGCCCTCATACGC
ATCGTGGACATCGGCGGCTCCTACAAGAAGATGACGAGGCTCTTTGGCGCCCGTTTCCTCGATTTCTCCG
AGCAATCGAGGATTTGCATGAACCCGTTCACGAACGTCATGGACCCTGCGGGCGATCTCCCCGTCATCGC
TTCCATCGTCCTGCAGATGGTCTACTCGTCCACGGACATCGTCCCGGAGGACACGGCGGAGACGGCCATG
TCGCTCATCAAGTCGGCGGTCAAGTGGGCCTGGCGGACGGAAGGAGCGGACGCCTCAATCGACACCGTCT
ACGAGTACCTGTCCACCTTCCCTGAGCACGCGGAGGAGTTCGATTCCTGCCACGAGAATGATATCGCGGC
ATTCCGGTCCCTTTCTCGCAACCTCTCGTTCAACCTGACAGAATTCACGAGCGGGCACCTCTACGGGAAA
TGGTTCAACGGGACTTCCGATTTCAACATCGCCGGAGATGAGTTTGTCGTCCTCGAATTGGAACATCTAA
AACCCCAGAAGGAGCTCTTCAAGGTCATTACGCTCCAAGTGATCAACGCCGTGACTCAGGACCTCTATAT
CTCAGACCGGTCGAGGCCCAGGTTCATCATTTTCGACGAGGCGTGGCAGTTCATGCAGGAGGGAAGCTCA
CTGAAAGGGGTCATTGAAGAAGGATACCGGCGGGCGAGAAAATACGGTGGGAGCTTCACGGTCATCACAC
AGTCCATTCTCGATTTGAAGCAGTTCGGAAGCATCGGGGACGTGATCCGTTCAAACAGCGCCTTCAAGTT
TTATCTGGAATCCAGCGATTTCGATCGGGCGAAGCTGGAGGGTCTGATCGAGCACGAAGGGTTCGCCCTC
AAGATCCTGAAGTCGGTCCGGAGCAACAAGCCCAAGTACTCGGAGATCTTCATGGACACCCCGTTCGGTC
AGGGCGTGGCCAGGCTCGCCGTGGACCCCTTCTCCTATTACCTCTACACGTCCGATGCGGCGGAAATCGC
CGAGATCGAATCCCTCGTGGACAACGGAATGAGCTATGGCGAAGCGATCAATGAAATGGTCAAGAGATAC
AGGACGGCCGGTTAG
 Primer design