SecReT4
Protein ID: 85859525
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01867
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1748529..1752758 [+]
Producthypothetical protein
Component typeTraN_F
UniProt IDQ2LTZ7
KEGG IDsat:SYN_01867
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.4e-15, Aligned region: 1200..1363
Protein Sequence: 1409 a.a.     [Download]
>gi|85859525|ref|YP_461727.1| hypothetical protein SYN_01867 [Syntrophus aciditrophicus SB]
MKKPFEIIFLVLLLAVFSPCLETVYADGSQKICAKDLNGDGNVDFTSEVANCVTVQGSDFCPLGAVNCGL
GVMDPLCPTNGTGCPGGTYNPTLNRCERPQIVTGYKCPTTGTTYGDQASCQNACIQTAVCQTGTYSVSVS
PDQSSSYWFYNGAYRMFCSGNGLYLSANPGGSSRSWTLSGASCSGDANGGENAFITYLQGSGNQLYVYGC
DGMQDPEYGSWTPVNCGRLFGVLTFDHAVVSGSTRGTSCILDDASYLSFHDRCDWATWTGIGISGDSYQN
CPLGNYPCSGGTCLTGSACTAVNGCPSGYQLVSGICIAQPQGGVAVTVDRSTHLCEAPVTNSCTGDGFSF
DPTGDSCVKNPGCGEGMLEGGLDLCIFNIGSDRCPAGFEYNAAFSACTRDAACPGGGILNRLRDICETAN
VSSCPEGTAMDPGSGNCLADPSCQVGNFDADLGECVLSAASLAQAGYVFNPGLDRFERPPSCPDGSSYSD
AADLCTTPAGHACPSPGVYNASSGKCEGTGVPVCPAAGMTYDDAAGACYAPAACPGAGATLNDVTDLCEA
AFTPACAGGYSWNPARLLCEMDPFCSPGMYNPARDRCESAPSGTSCPASYAWNGSAGKCQASPSCSAGAY
NPVTDRCEQSATASYACSLGGSYPSLPACSSSCAQSAACSTVTPNVTLSGPQAWCQPSRIVCSDGTLTFY
CSQGGSLSYNVTGMNCSSDVSLPSGYYISYLVGSGQGFTIYGCQNVYDPEFGYYPNGICDFTGYVSTQGV
NVTGSTYPGTPGYWNALDALGVNTFPGYPNALWGHDSTIWTPWYPLYFNGIPYQVCPLGNYACSGGYCSA
PGACSGPTYSCPVGWTLSGSTCYQAAGCPAGGSLNGTSEKCEAAGTPTCSNGTYDPANGVCYQAVTCPNG
GSLNGSVDKCQLAPPNSCQTGYTLDSGRGLCTALPQCAAGAYHSSRDRCEQAFATGCAADYTWNGGRGLC
ESNPTHDCPLYGFSYNPAIDLCSKEVLCPGGGYLSGEADRCVVQMYSGTCPAGFVYNPSTDSCLRDPSCS
AGVLNPTTRKCVAPPADGCASGYAYNSGTGTCQIPPVCETGTYDGGIDKCAVPGSTLCPTQYTFNSLESR
CERLPSCSDGAMYLASMDLCMKDPVRQCPTSDYTYQASSRQCVAPPVCYVGNFDPVTNTCAGSSTGCPLG
SQYACLPNPATGILQCSDNACFNPSAMPTQTTGADTSSYHNDGTVDPSTGDCQGALYIFNGKGKECRTAG
ISTTFFNCCNTDPGGFLFIQNTCGSGDAETVQAVGKGMCHYIGDYCQQKWPLIGCVQRANTYCCFNSKLG
RIIHEQGRAQLQQFGASGDWGGAENPNCRGFTPEEFQMLDFSRIDLSEYFGDIKAKATSEVQQDMQRQVS
DFYEKVERK
 
Nucleotide Sequence: 4230 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1748529-1752758 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAGAAGCCCTTCGAAATCATTTTCCTTGTCCTCCTCCTCGCGGTGTTCTCCCCTTGCCTGGAAACGG
TCTACGCGGACGGATCGCAGAAAATCTGCGCGAAGGACCTGAACGGGGACGGCAACGTCGATTTCACGAG
CGAGGTTGCCAACTGCGTGACCGTCCAAGGCAGCGATTTTTGTCCTCTGGGAGCGGTCAATTGCGGGCTG
GGCGTGATGGATCCCCTGTGTCCCACCAACGGGACGGGCTGCCCCGGGGGGACGTACAATCCCACGCTGA
ACAGGTGCGAAAGACCGCAGATCGTGACCGGCTACAAGTGCCCGACGACAGGGACGACTTACGGGGACCA
GGCCTCGTGCCAGAACGCCTGCATCCAGACGGCCGTCTGCCAGACCGGGACGTATTCCGTCTCCGTCTCT
CCGGACCAATCGAGCTCGTACTGGTTTTACAACGGTGCTTACCGGATGTTCTGCAGCGGAAACGGTCTTT
ACCTGTCGGCGAACCCGGGAGGAAGCAGCCGGAGCTGGACTCTTTCGGGCGCCTCCTGCTCCGGGGACGC
GAACGGCGGTGAAAACGCTTTTATCACCTACCTCCAGGGAAGCGGCAACCAGCTTTACGTTTACGGCTGC
GATGGGATGCAGGATCCGGAGTACGGCTCCTGGACGCCGGTCAATTGCGGCCGGCTTTTCGGCGTTCTCA
CGTTCGATCACGCAGTAGTGAGCGGATCAACGAGGGGCACGTCCTGCATACTCGACGACGCTTCGTATCT
CTCTTTTCATGACCGGTGCGACTGGGCGACGTGGACGGGCATCGGGATATCGGGCGACTCCTATCAGAAC
TGTCCCCTCGGAAATTATCCCTGCAGCGGAGGGACCTGTTTGACCGGATCCGCCTGCACCGCCGTTAACG
GCTGCCCGTCCGGCTACCAGCTTGTAAGCGGTATCTGCATCGCCCAGCCCCAAGGGGGCGTGGCCGTGAC
AGTCGACAGATCGACTCATCTGTGTGAAGCCCCCGTGACGAACAGCTGCACGGGAGACGGCTTTTCCTTC
GACCCAACCGGCGACTCCTGCGTCAAGAATCCGGGTTGCGGCGAAGGCATGCTGGAAGGCGGCCTCGACC
TCTGCATATTCAATATCGGGAGCGACCGGTGTCCGGCCGGCTTCGAATATAACGCGGCATTCTCAGCCTG
TACCAGGGACGCGGCCTGCCCGGGCGGCGGAATCCTCAACCGGTTGCGGGACATTTGCGAGACGGCAAAT
GTCTCGTCCTGTCCGGAAGGGACGGCCATGGACCCGGGATCGGGTAACTGCCTCGCGGACCCTTCCTGCC
AGGTCGGAAATTTCGACGCGGACCTCGGTGAATGCGTCCTTTCGGCGGCGTCCCTCGCCCAGGCGGGATA
CGTCTTCAATCCCGGCCTTGATCGGTTCGAACGGCCGCCGTCCTGCCCCGACGGGAGCTCGTACTCGGAT
GCGGCGGATCTCTGCACGACTCCCGCCGGTCACGCGTGTCCTTCCCCCGGCGTTTACAACGCTTCATCGG
GAAAATGCGAGGGCACGGGCGTACCGGTATGCCCGGCCGCGGGCATGACCTACGACGACGCGGCCGGAGC
CTGTTACGCCCCCGCCGCCTGTCCCGGCGCCGGAGCGACCCTGAACGACGTGACGGACCTGTGCGAGGCG
GCTTTCACGCCCGCGTGCGCGGGAGGATATTCATGGAACCCGGCAAGGTTGCTATGCGAGATGGATCCTT
TCTGTTCCCCTGGGATGTACAATCCCGCGAGAGACAGGTGCGAATCGGCCCCGTCCGGGACGTCCTGCCC
GGCGTCTTATGCCTGGAACGGCTCGGCCGGTAAATGCCAGGCGTCGCCGTCCTGTTCCGCCGGCGCCTAT
AATCCCGTCACCGATCGGTGCGAACAGTCCGCGACGGCCAGCTACGCGTGTTCACTCGGAGGGAGTTATC
CGAGCCTTCCCGCGTGTTCTTCCTCGTGCGCGCAATCGGCCGCCTGCAGCACCGTTACCCCGAACGTGAC
GCTGTCGGGACCGCAGGCCTGGTGTCAGCCCAGCCGCATCGTCTGTTCCGACGGCACTCTTACCTTCTAT
TGCAGCCAGGGCGGTTCCCTGTCTTACAACGTGACGGGCATGAACTGTTCATCGGACGTATCCCTTCCCA
GCGGTTACTATATTTCCTACCTCGTGGGATCGGGACAGGGATTCACCATTTACGGATGTCAAAACGTGTA
CGATCCGGAATTCGGATACTACCCCAACGGGATTTGCGACTTCACCGGTTACGTAAGCACGCAGGGCGTC
AACGTCACGGGTTCGACTTATCCCGGCACGCCGGGTTACTGGAACGCCCTGGACGCCCTGGGCGTAAACA
CCTTTCCCGGCTACCCGAACGCGCTTTGGGGGCATGATTCAACGATCTGGACGCCCTGGTACCCCCTTTA
TTTCAACGGCATCCCTTACCAAGTCTGCCCTCTGGGTAATTATGCCTGCAGCGGGGGGTACTGCTCAGCA
CCGGGAGCCTGTTCCGGCCCCACCTATTCCTGCCCGGTCGGCTGGACCCTTTCCGGCTCCACCTGCTACC
AGGCCGCAGGTTGCCCGGCGGGCGGGAGCCTGAACGGTACCTCCGAGAAATGCGAGGCGGCCGGCACGCC
GACTTGTTCAAACGGCACGTATGATCCTGCTAATGGGGTCTGCTACCAAGCCGTAACCTGTCCCAACGGC
GGCAGCCTGAACGGTTCGGTCGATAAGTGCCAGCTCGCCCCCCCCAATTCCTGCCAAACCGGTTATACCC
TGGATTCGGGAAGGGGCCTCTGCACTGCTCTTCCACAATGTGCGGCAGGGGCCTATCATTCCAGTCGCGA
CCGGTGCGAGCAGGCGTTCGCTACCGGCTGCGCCGCCGATTATACCTGGAACGGCGGCAGGGGCCTGTGC
GAATCCAATCCCACGCACGACTGCCCCCTGTACGGGTTTTCTTACAACCCGGCGATCGATCTCTGCTCGA
AAGAAGTTCTCTGCCCGGGCGGCGGATATCTCAGCGGCGAAGCCGATCGTTGCGTTGTCCAGATGTATTC
GGGAACATGCCCCGCGGGGTTCGTCTACAACCCGTCGACTGATTCCTGCTTGCGCGATCCTTCCTGCTCG
GCCGGCGTTTTGAATCCAACGACCCGGAAATGCGTTGCACCTCCGGCCGACGGCTGCGCGAGCGGGTACG
CTTACAATTCCGGTACCGGAACGTGCCAAATACCCCCGGTGTGCGAGACTGGAACATACGACGGCGGGAT
CGACAAATGCGCGGTTCCCGGTTCAACCCTCTGTCCGACCCAGTACACGTTCAATTCCCTTGAATCGCGG
TGTGAGCGTCTTCCCTCCTGCAGTGACGGGGCGATGTATTTGGCCTCCATGGACCTCTGCATGAAGGACC
CGGTCCGGCAGTGTCCCACTTCCGATTACACGTACCAGGCTTCCTCCAGGCAGTGCGTCGCACCTCCTGT
CTGTTACGTGGGGAACTTCGATCCTGTCACGAATACGTGCGCGGGATCGTCCACGGGCTGTCCCCTCGGA
TCGCAATATGCCTGCCTTCCGAACCCGGCGACCGGGATTCTGCAGTGCTCCGATAACGCCTGTTTCAACC
CGTCCGCCATGCCCACCCAAACGACCGGCGCGGACACGTCCTCCTATCACAACGACGGCACGGTGGACCC
TTCGACCGGCGATTGCCAAGGCGCCTTGTACATATTCAACGGGAAGGGAAAAGAATGCAGAACCGCCGGG
ATCAGCACGACCTTCTTCAACTGCTGCAATACCGATCCCGGAGGCTTTCTCTTCATCCAGAACACGTGCG
GCTCCGGGGACGCGGAAACGGTGCAGGCGGTCGGCAAAGGGATGTGCCATTACATCGGGGATTATTGTCA
GCAGAAATGGCCCCTCATCGGGTGTGTCCAGAGGGCGAACACTTACTGCTGTTTCAATTCCAAGCTCGGC
AGGATCATCCATGAACAAGGGAGAGCGCAGCTCCAACAATTCGGCGCAAGCGGCGACTGGGGAGGCGCGG
AGAACCCTAACTGCCGGGGCTTCACCCCGGAGGAATTCCAGATGCTCGATTTCTCCCGGATCGACCTCTC
GGAGTACTTCGGAGACATCAAGGCGAAGGCGACATCGGAAGTGCAACAGGACATGCAGCGGCAGGTCTCG
GATTTCTATGAAAAGGTTGAGCGGAAATGA
 Primer design