SecReT4
Protein ID: 85859526
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01868
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1752736..1753569 [+]
Productcytoplasmic protein
Component typeTraW_F
UniProt IDQ2LTZ6
KEGG IDsat:SYN_01868
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 1.6e-09, Aligned region: 71..99
Protein Sequence: 277 a.a.     [Download]
>gi|85859526|ref|YP_461728.1| cytoplasmic protein [Syntrophus aciditrophicus SB]
MKRLSGNEFMPADRFAELPARDLHCLQENFRAWRGEIPAAGRPGMRGMPRPKWTYTQSARTTAREKMKKV
FILAVLSSLLLAQAAVCADLGNIGATYPVVERDALSEIEERAKAVDWGKAFDPKRTRERIQNYRPEGMEA
LPAAKKDRVFQVDVSYTLDFDIPDGRGGILYLRGFSFNPLAHVFLPNILVVIDGGNERQIEWFKASSYAK
DHRVMLLLCGGPYTRVMEKLKRPAFYADARIVKRFQLKAVPAVIVQKGTVMEVREYALDDKGQKKRK
 
Nucleotide Sequence: 834 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1752736-1753569 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAAAGGTTGAGCGGAAATGAGTTTATGCCCGCCGATCGATTCGCGGAATTACCCGCGCGAGACCTGC
ATTGTTTGCAAGAAAACTTTCGGGCCTGGAGAGGGGAGATACCTGCGGCCGGAAGGCCTGGTATGCGTGG
AATGCCACGACCGAAATGGACGTATACCCAAAGCGCGCGTACGACCGCGAGGGAGAAAATGAAAAAGGTC
TTCATCCTGGCAGTCCTGTCCTCCTTGCTCCTGGCCCAAGCGGCGGTTTGCGCCGATCTCGGCAATATTG
GGGCGACTTATCCCGTCGTCGAGCGCGACGCACTCTCCGAAATCGAGGAGCGGGCAAAGGCGGTCGACTG
GGGAAAGGCATTTGACCCGAAAAGGACGCGCGAAAGAATTCAAAACTACCGACCCGAGGGGATGGAGGCC
TTGCCGGCGGCGAAGAAGGACCGGGTCTTCCAGGTGGACGTGAGTTACACGCTCGATTTCGACATCCCCG
ACGGGAGGGGCGGGATCCTCTATCTTAGGGGCTTCAGTTTCAACCCCTTGGCCCATGTATTTCTTCCCAA
CATCCTCGTCGTGATCGACGGGGGTAACGAGAGACAGATCGAATGGTTCAAGGCGTCCTCCTACGCAAAA
GACCATAGGGTCATGCTCCTCCTTTGCGGGGGACCGTATACCCGGGTCATGGAGAAGCTGAAGAGACCGG
CGTTCTACGCGGACGCCAGAATCGTGAAAAGGTTTCAACTGAAGGCGGTCCCCGCCGTGATCGTTCAAAA
GGGTACCGTCATGGAGGTGAGAGAATATGCCCTCGACGACAAGGGGCAAAAGAAGCGGAAGTAG
 Primer design