SecReT4
Protein ID: 85859527
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01869
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1753532..1754551 [+]
Productconjugal DNA transfer protein
Component typeTraU_F
UniProt IDQ2LU05
KEGG IDsat:SYN_01869
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.6e-73, Aligned region: 41..338
Protein Sequence: 339 a.a.     [Download]
>gi|85859527|ref|YP_461729.1| conjugal DNA transfer protein [Syntrophus aciditrophicus SB]
MPSTTRGKRSGSRDVVKGFFVLLILFHAVGAQAVCRSGIPLNPVTDLCWQCIFPVSIAGIEIIPGPVENN
VPDLSGMPVCACPAPPPLFIRIGIPVSFWEPARYVETVKDPYCFPSLGFGLTAAGGFLGGGSQEQGNASV
DTSTFAQAHYFIYPVWSIMELLTDFACIEHSGFDVAYLTEVDPLWQNDILAFILEPESILFGNPIAQTAC
IADSVSTNAGFSMSPLFWCIGSGGSAYPLTGHVNDDNELMANSTIAARMVYKLAREGLVCDTALNLCACV
PTPIWVKHNWRMHVAKPVRDFMCHPFGRTGLIWGALKNPPLVGDNFVWQLFRRRSCCAF
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1753532-1754551 Syntrophus aciditrophicus SB chromosome, complete genome
ATGCCCTCGACGACAAGGGGCAAAAGAAGCGGAAGTAGGGACGTCGTGAAGGGGTTTTTCGTTCTCCTCA
TTCTCTTTCACGCCGTTGGAGCACAGGCTGTATGCAGGTCCGGGATTCCGTTGAACCCGGTGACCGACCT
CTGCTGGCAGTGCATATTCCCGGTGAGCATCGCCGGGATCGAGATCATTCCCGGCCCGGTGGAAAACAAC
GTTCCGGACCTTTCGGGCATGCCCGTCTGCGCGTGTCCGGCGCCGCCCCCGCTCTTCATCAGGATCGGCA
TCCCCGTCAGCTTCTGGGAACCGGCCAGGTACGTGGAAACAGTCAAGGATCCTTACTGCTTCCCGAGCCT
GGGCTTCGGCCTCACCGCGGCGGGCGGCTTTCTCGGCGGGGGCTCGCAGGAGCAGGGGAACGCGAGTGTG
GATACCTCCACCTTTGCCCAGGCGCATTACTTTATTTATCCCGTTTGGTCCATTATGGAGCTCCTTACCG
ATTTTGCCTGCATCGAGCACAGCGGTTTCGACGTTGCGTACCTCACGGAGGTGGACCCTCTCTGGCAGAA
TGACATCCTTGCCTTCATTCTGGAGCCGGAGTCGATCCTCTTCGGGAATCCCATCGCCCAGACGGCCTGC
ATCGCCGACAGCGTCTCGACCAACGCGGGTTTCTCCATGAGCCCCCTTTTCTGGTGCATCGGCTCGGGCG
GGAGCGCCTACCCGCTCACGGGGCACGTGAACGACGACAACGAGCTCATGGCCAATTCCACGATCGCCGC
CCGGATGGTTTACAAGTTGGCCAGGGAGGGGCTCGTCTGCGACACGGCCCTCAACCTGTGCGCCTGCGTC
CCCACGCCCATCTGGGTGAAGCACAACTGGCGCATGCACGTCGCCAAGCCGGTGCGCGACTTCATGTGCC
ATCCCTTCGGGAGGACGGGGCTCATCTGGGGAGCGCTCAAGAACCCGCCGCTCGTAGGGGACAACTTCGT
CTGGCAGCTCTTCAGGAGAAGGTCATGCTGCGCTTTCTGA
 Primer design