SecReT4
Protein ID: 85859531
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01873
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1756226..1757128 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ2LU01
KEGG IDsat:SYN_01873
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.9e-44, Aligned region: 51..263
Protein Sequence: 300 a.a.     [Download]
>gi|85859531|ref|YP_461733.1| hypothetical protein SYN_01873 [Syntrophus aciditrophicus SB]
MPVRSSEKKLMFRVLIICQVVLLFTTGTPCAGEPPFMEENGKAYYGDAKRGWWWYEKIPLEKRDRDEKVE
DGKKRSPRLSDYTMEELWNMYPDDFQAVLMAFQKKAVQVPSENNVREYYVVQDIARRKSLAFANVSAAVM
QKYPDLSVAADYPITAPGRNAEVSQRTDEIKSRIRSAREEFALIYFSSAGCPYCAEEGSILSRFVEKYGW
EIREIDIEREAAVSSVFGIETTPTLLLIYRGSADHITVSAGVASLAELEEKLYRGLRLLKNEITPEEYSL
YEFQRGGAFDVKAPLRRDKR
 
Nucleotide Sequence: 903 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1756226-1757128 Syntrophus aciditrophicus SB chromosome, complete genome
TTGCCTGTCCGCTCTTCTGAGAAGAAATTGATGTTCCGGGTCCTGATCATTTGCCAGGTTGTCCTTCTTT
TCACGACGGGCACCCCTTGCGCCGGGGAACCGCCGTTCATGGAGGAAAACGGCAAGGCGTATTACGGGGA
CGCCAAGCGGGGCTGGTGGTGGTACGAGAAGATCCCCTTGGAGAAAAGGGACCGGGACGAGAAAGTCGAG
GACGGTAAGAAGCGCTCTCCGCGCCTTTCGGACTACACAATGGAGGAACTCTGGAATATGTACCCCGACG
ATTTCCAGGCCGTCCTCATGGCCTTCCAGAAGAAGGCCGTCCAGGTCCCCTCGGAAAATAACGTGAGGGA
ATATTACGTGGTCCAGGACATCGCCCGGAGAAAGTCCCTCGCCTTCGCCAACGTGTCCGCGGCGGTCATG
CAGAAATACCCGGACCTCTCCGTGGCGGCCGACTACCCGATCACGGCCCCGGGAAGAAACGCCGAGGTCT
CGCAACGGACGGACGAGATCAAATCAAGGATCCGGAGCGCCCGGGAAGAATTCGCGCTCATCTATTTTTC
CTCTGCGGGCTGCCCGTACTGTGCCGAGGAGGGTTCGATTCTCAGCCGTTTCGTCGAGAAGTACGGGTGG
GAGATCCGGGAAATCGACATAGAAAGGGAGGCGGCGGTATCGTCCGTCTTCGGGATCGAGACGACTCCGA
CCCTTCTTCTCATTTATCGTGGGAGCGCCGACCATATCACCGTTTCGGCCGGAGTGGCATCCCTGGCCGA
GCTCGAGGAAAAACTCTACCGGGGACTCCGGCTTTTGAAAAACGAGATCACCCCGGAGGAGTATTCTCTC
TACGAGTTCCAGCGGGGCGGCGCCTTCGATGTGAAGGCTCCCTTGAGGCGGGACAAAAGATAA
 Primer design