SecReT4
Protein ID: 85859532
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01874
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1757139..1758605 [+]
Productpilus assembly protein
Component typeTraH_F
UniProt IDQ2LU06
KEGG IDsat:SYN_01874
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 8.9e-91, Aligned region: 35..385
Protein Sequence: 488 a.a.     [Download]
>gi|85859532|ref|YP_461734.1| pilus assembly protein [Syntrophus aciditrophicus SB]
MAMNKGIILKSIVVLVIIALLLSPLGPDGPMAGWVDDWLQQKTETSPGYFEGQKRGYFTGGSFSARWQQG
NDYLFTAMPPKVKAGCGGIDVFLGGFSYLNFEYLVTKLQRIMQAAPAAAFDIALNVLCEPCSKTIKSLEA
ITNTLNNLQLDECKAGRALVATMVPPSLAETKDKQAKLAGIQGDFLQSSGVNDLWKSINDQTSANANKPV
TNMKQALAGCPQDIRDVFGTSGSVINNIAAKTGFNNQSYLDMLRGFVGDVYIIDAGDAGFQVGHTPPCDQ
NRYASFDNLLDGSVYARTAGGACAQITDSSADLTNYVRTKMTRIAGKIKAKQALSDEDNAFVNASPLSIG
LVLKAAVGTNQESSIISTLSDVTAKAYAFQLLSDLYTKVWNIMEKARSLAQAQPGAVQGAQEYQCKIEML
SGAIDGTAEMQARIVEMVSGVRRSYAASVQEVMGVYNLVDKMEKFDRLALSMLSSKFGTAVAARSLSR
 
Nucleotide Sequence: 1467 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1757139-1758605 Syntrophus aciditrophicus SB chromosome, complete genome
GTGGCTATGAATAAAGGAATTATTCTCAAAAGCATCGTGGTCCTTGTAATTATTGCTCTCCTCCTGTCGC
CCCTTGGCCCGGACGGGCCTATGGCTGGCTGGGTTGACGACTGGCTCCAGCAGAAAACGGAGACCTCCCC
TGGGTACTTCGAGGGGCAGAAAAGGGGTTATTTCACCGGCGGGAGCTTCTCGGCGAGGTGGCAGCAGGGA
AACGACTACCTCTTCACCGCCATGCCACCCAAGGTGAAGGCGGGCTGCGGCGGGATCGACGTCTTCCTGG
GCGGGTTCTCCTATCTGAATTTCGAATACCTGGTAACCAAGCTCCAGCGGATCATGCAGGCCGCACCGGC
GGCGGCCTTCGACATCGCTTTGAACGTTCTCTGCGAGCCCTGCTCGAAGACGATCAAGTCCCTGGAAGCT
ATCACCAACACCCTGAACAACCTGCAGCTCGATGAGTGCAAGGCGGGCCGGGCGCTCGTGGCGACCATGG
TGCCCCCGTCCCTCGCCGAAACGAAGGACAAACAGGCAAAGCTCGCCGGAATCCAGGGGGACTTCCTCCA
GTCATCGGGCGTTAACGACCTCTGGAAGAGCATCAACGACCAGACAAGCGCAAACGCGAACAAGCCGGTC
ACGAACATGAAGCAGGCACTCGCGGGCTGTCCCCAGGACATCCGGGACGTCTTCGGGACCAGCGGGTCGG
TCATCAACAACATCGCAGCCAAGACCGGCTTCAACAACCAGTCCTACCTCGACATGCTGAGAGGGTTCGT
CGGTGACGTATACATCATCGACGCCGGGGACGCGGGTTTCCAGGTGGGTCACACGCCCCCCTGCGATCAA
AACCGGTACGCCTCCTTCGACAACCTCTTGGACGGAAGCGTCTACGCCCGGACGGCAGGAGGCGCCTGCG
CACAAATTACCGACAGCTCGGCCGACCTCACGAATTACGTGCGGACGAAGATGACCCGGATCGCGGGAAA
GATCAAGGCGAAGCAGGCCCTCTCGGACGAGGACAACGCCTTCGTGAACGCTAGTCCCCTTTCCATCGGG
CTCGTTCTCAAGGCGGCCGTGGGAACGAACCAGGAGTCATCCATCATCAGTACCCTCTCCGACGTGACCG
CCAAGGCCTACGCCTTCCAGCTCCTCTCGGACCTCTACACGAAGGTCTGGAACATCATGGAAAAGGCGAG
GAGCCTCGCCCAGGCTCAGCCGGGGGCCGTGCAGGGCGCGCAGGAATACCAGTGCAAGATCGAGATGCTC
TCCGGTGCGATCGACGGCACGGCGGAGATGCAGGCCAGAATCGTGGAAATGGTAAGCGGAGTCCGGAGAT
CCTACGCCGCATCCGTCCAGGAGGTGATGGGGGTCTACAACCTGGTGGACAAGATGGAGAAATTCGACAG
GCTGGCCCTGAGCATGCTGAGTTCGAAATTCGGAACGGCCGTCGCGGCCAGGTCATTGTCACGCTGA
 Primer design