SecReT4
Protein ID: 85859533
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01875
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1758625..1761663 [+]
ProductDNA transfer and F pilus assembly protein
Component typeTraG_F
UniProt IDQ2LU10
KEGG IDsat:SYN_01875
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.8e-36, Aligned region: 30..493
Protein Sequence: 1012 a.a.     [Download]
>gi|85859533|ref|YP_461735.1| DNA transfer and F pilus assembly protein [Syntrophus aciditrophicus SB]
MGIFGKTILIFGFTVVMLSAAPDAHAVDMEYYTYNGFGAVVTAFQKISLIFSDNGYRALFFTVTALGIFI
AGAAAYFHLLKGARFSPLSWAWPVGLGICLYLGLMVPTGNITIYDPVLNRFQTVGRIPDGIVVVAGTLNK
IERGLVDIISTSGTPQNFQDYAGGIGFDMLLKASGGHLKIRDQYIDESLKRYTKDCLFFELQRPGTSLSV
NDVTSSSTDFMSQYAQAANPAVFTVWYSESDRTGTTMSCADAWTNLQGYFSDPLNMGDTIRFACANAGFN
ADNAGELTKCTEIISNYASYVEGGAFTIPAPNFMRQVYMAEVLNDMLLDANPDLAVKGLASRSIMTGGLG
MGIVANEWLPVARAVITAVAIGLIPILVIFIPTPLAGKALGLVAGMFIWLTAWGVTDAITHGIATDYAYG
VFEYVRQNALGFAAVMNMPDASLKALSMFGLIRTSGIMLATVITGMLVRFGGHALAMMAGTISGTVQSQG
SQAASQASTPEGGARSMDSARTAIPTWSNANRWSIQDYSDLETARRVGSTAGMMKVRDEFGADRLGGMHG
DAAVGGFLPRAAAGSGMVEVGLDRSQGLLKAGNISRLGKTEGDLESFRESGHAGDFFDYHADQAAVEGKK
RYFAAMKYDEAMEEAGRGDRISGYRAVADYDAHKTAGVIREGEKHGVEAKALGETKGRLDALQTVAAFRG
IEAVGEGAYLDARRDAVIDDVAKWGALRSFAESRGVDFERFAADRHRTADISVNAAEAERYGLPGAGSYR
MAWGGHGELLFTNRSSGSQYQVGTFGKSGRDIAGYNISRSEEGNLRKIYSNFTDRVGGSHSVRYDDFRES
VSGFRGRGYNVSIVEDASMAGGHRVMVFDPSHKKPVLVSGNINHLVSSYRQTADGATKEAIVPLTGDVLA
SESTIGSVRTQNQDRLNVNMGVKADGTVTEGVRKVAGETVAVGAAASMDGLASIGSTVRSVKQLGELGNN
FKLNRTKGEPTLEGGETAKGEISPGPASDPVQ
 
Nucleotide Sequence: 3039 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1758625-1761663 Syntrophus aciditrophicus SB chromosome, complete genome
ATGGGAATTTTTGGAAAGACAATTCTTATATTTGGCTTCACGGTCGTCATGTTGTCAGCTGCACCGGACG
CCCATGCAGTGGACATGGAGTACTATACCTACAACGGCTTCGGAGCCGTCGTGACTGCCTTCCAGAAGAT
ATCCCTGATCTTTTCGGATAACGGCTATCGGGCGCTCTTCTTCACCGTGACCGCCCTCGGGATCTTCATC
GCCGGGGCTGCGGCGTACTTCCATCTCCTCAAGGGGGCAAGGTTTTCGCCCCTCTCATGGGCCTGGCCGG
TGGGTCTCGGGATATGCCTCTATCTTGGGCTCATGGTACCCACGGGAAACATCACGATCTACGATCCTGT
CCTCAACCGCTTCCAGACCGTCGGGCGGATCCCTGACGGCATCGTGGTCGTGGCCGGGACCCTGAACAAG
ATCGAACGGGGACTCGTGGATATCATCTCCACGTCGGGCACGCCCCAGAATTTCCAGGACTACGCCGGCG
GCATAGGCTTCGACATGCTTTTGAAGGCATCCGGGGGGCACCTCAAAATCCGGGACCAGTACATCGATGA
ATCGCTGAAACGGTACACAAAGGACTGCCTGTTCTTCGAGCTGCAGCGGCCGGGGACGTCGTTGAGCGTA
AACGACGTCACGAGTTCCAGCACGGACTTCATGAGCCAGTACGCCCAGGCAGCGAACCCGGCCGTCTTCA
CCGTCTGGTATTCGGAATCGGACCGAACCGGGACGACCATGTCCTGCGCGGATGCCTGGACCAACTTGCA
AGGTTACTTCAGCGATCCCCTCAACATGGGAGACACGATCCGCTTTGCCTGTGCGAACGCCGGCTTCAAT
GCGGACAACGCCGGTGAGCTCACGAAATGCACGGAGATCATCTCGAACTACGCCTCCTACGTGGAGGGCG
GCGCATTCACGATCCCGGCACCGAACTTCATGAGACAGGTCTACATGGCCGAAGTATTGAATGACATGCT
GCTCGACGCGAACCCCGATCTTGCCGTGAAGGGCCTGGCGTCGAGGAGCATCATGACCGGCGGGCTCGGC
ATGGGAATCGTGGCGAACGAGTGGCTTCCCGTGGCGAGGGCTGTAATCACGGCCGTGGCCATCGGTCTCA
TACCGATCCTCGTCATTTTCATTCCCACACCGCTCGCGGGAAAGGCCCTGGGACTCGTCGCGGGGATGTT
CATCTGGCTCACGGCCTGGGGCGTGACCGACGCGATCACCCACGGGATCGCGACCGACTATGCCTACGGG
GTCTTCGAGTACGTGAGGCAAAACGCCCTGGGCTTCGCGGCCGTCATGAACATGCCCGACGCGTCTCTCA
AGGCCCTCAGCATGTTCGGCCTCATCAGGACCTCGGGCATCATGCTGGCCACGGTGATCACAGGGATGCT
CGTCCGGTTCGGCGGGCATGCCTTGGCCATGATGGCGGGGACCATCTCCGGGACGGTCCAGTCCCAGGGG
AGCCAGGCGGCCTCACAGGCGTCAACGCCGGAAGGGGGGGCGAGATCCATGGACTCGGCGAGAACGGCCA
TTCCCACCTGGTCGAACGCCAACCGCTGGAGCATCCAGGACTACTCAGACCTGGAGACGGCAAGACGCGT
GGGCTCAACTGCCGGAATGATGAAGGTCCGCGACGAATTCGGGGCGGACCGGTTGGGCGGTATGCACGGG
GACGCGGCAGTGGGCGGCTTTCTCCCCCGCGCGGCGGCCGGGTCCGGAATGGTGGAAGTGGGCCTCGACC
GGTCGCAAGGTCTTCTCAAGGCCGGAAACATCTCCAGGCTGGGAAAAACCGAGGGCGACCTCGAATCTTT
CCGTGAGTCGGGCCATGCCGGGGACTTTTTCGACTACCATGCCGATCAGGCAGCCGTGGAGGGAAAGAAA
CGGTACTTCGCCGCCATGAAATACGACGAGGCGATGGAGGAGGCAGGCCGAGGAGACCGGATATCGGGCT
ACAGAGCCGTGGCCGACTACGATGCCCACAAGACGGCGGGAGTGATCCGGGAGGGAGAGAAACACGGCGT
TGAAGCGAAAGCGCTCGGAGAGACAAAGGGTCGGTTGGACGCGCTCCAGACCGTGGCCGCCTTCAGGGGG
ATCGAAGCCGTCGGCGAGGGCGCCTATCTTGACGCGAGGCGGGACGCCGTGATCGACGATGTCGCCAAGT
GGGGAGCGCTCCGGTCCTTCGCCGAATCCAGAGGAGTGGATTTTGAACGTTTCGCGGCGGACCGGCACCG
AACGGCCGATATCTCCGTGAACGCCGCTGAAGCAGAGCGGTACGGCCTCCCCGGGGCGGGGAGCTACCGC
ATGGCCTGGGGAGGGCATGGCGAACTGCTCTTCACCAACCGGTCCAGCGGAAGCCAGTATCAGGTCGGTA
CCTTCGGGAAGAGCGGGCGGGATATTGCGGGATACAATATATCCAGAAGCGAGGAAGGAAACCTCAGAAA
GATATACAGCAATTTCACGGACCGGGTGGGAGGATCACACAGCGTCCGCTACGATGATTTCCGGGAAAGC
GTCTCGGGGTTCCGGGGCAGAGGCTACAATGTGAGTATTGTCGAGGACGCATCGATGGCGGGCGGCCATC
GCGTGATGGTCTTCGACCCTTCACACAAAAAACCGGTACTCGTTTCCGGGAACATCAATCACCTCGTGAG
TTCTTACCGGCAGACGGCAGACGGCGCCACTAAGGAAGCGATCGTCCCACTGACAGGAGACGTCCTCGCT
TCTGAAAGCACGATCGGAAGTGTCCGGACGCAAAACCAGGACAGGCTGAACGTAAACATGGGTGTGAAGG
CGGATGGAACTGTTACGGAAGGAGTGAGAAAAGTGGCGGGCGAAACGGTCGCGGTGGGCGCGGCTGCTTC
CATGGACGGACTGGCATCCATCGGGAGTACTGTAAGGAGCGTAAAACAACTGGGCGAACTCGGAAATAAT
TTCAAGTTGAACAGGACCAAGGGGGAGCCGACCCTTGAGGGTGGTGAAACAGCGAAGGGCGAGATATCTC
CCGGCCCTGCAAGTGATCCCGTGCAATAA
 Primer design