SecReT4
Protein ID: 85859541
T4SS name [ID]Tra_F [552]
Gene symbol-
Locus tagSYN_01884
StrainSyntrophus aciditrophicus SB
Repliconchromosome [GenBank: NC_007759] [Browse all T4SS(s) in this replicon]
Location [Strand]1765405..1765815 [+]
Productsoluble lytic murein transglycosylase
Component typeOrf169_F
UniProt IDQ2LU11
KEGG IDsat:SYN_01884
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 136 a.a.     [Download]
>gi|85859541|ref|YP_461743.1| soluble lytic murein transglycosylase [Syntrophus aciditrophicus SB]
MKKVVVLFSLLFLFPAGQLHAFCFEEAGSIYNVSPRLLWAIARVESGFRPGALNRNADGSYDYGLMQINS
SWARVVGKELWSSLGDPCTNVKVGAWILSDCIRKHGYTWEAVGAYNASQKHKRARYARKVYTALRK
 
Nucleotide Sequence: 411 bp     [Download]
>gi|85857845|ref|NC_007759.1|:1765405-1765815 Syntrophus aciditrophicus SB chromosome, complete genome
ATGAAAAAAGTCGTCGTCCTCTTTTCATTACTTTTCCTCTTTCCCGCGGGGCAACTCCATGCCTTCTGCT
TCGAGGAGGCAGGCTCCATCTATAACGTCTCCCCCCGACTTCTCTGGGCCATCGCCAGGGTGGAGAGCGG
TTTTCGGCCCGGCGCTCTCAACCGCAACGCCGACGGCTCGTATGACTACGGACTCATGCAGATCAATTCC
TCATGGGCGCGGGTCGTAGGAAAGGAGCTTTGGTCCTCCCTGGGCGATCCGTGCACGAACGTGAAGGTCG
GCGCCTGGATCCTCTCCGATTGCATCCGGAAACACGGCTACACATGGGAAGCTGTCGGAGCCTATAACGC
CTCCCAGAAACACAAACGCGCCAGGTACGCCAGGAAGGTATACACGGCCCTGCGGAAATGA
 Primer design