SecReT4
Protein ID: 86359736
T4SS name [ID]VirB [18]
Gene symbol-
Locus tagRHE_PA00031
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]34930..35274 [-]
Producthypothetical protein
Component typeVirB11
UniProt IDQ2K2C2
KEGG IDret:RHE_PA00031
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.1e-11, Aligned region: 36..106
Protein Sequence: 114 a.a.     [Download]
>gi|86359736|ref|YP_471627.1| hypothetical protein RHE_PA00031 [Rhizobium etli CFN 42]
MVPRKWLCRGQDRAHEADEADRATGHQPSQRLGAYSDVMEYHEIPSLTAAEIKNIGERVAGATNQFISRA
NPMLSAALPTGERSQIVLPPAAADGGAISIRKQTPSSRCGAWRP
 
Nucleotide Sequence: 345 bp     [Download]
>gi|86359705|ref|NC_007762.1|:c35274-34930 Rhizobium etli CFN 42 plasmid p42a, complete sequence
GTGGTGCCTCGCAAATGGTTATGCCGAGGTCAAGACCGGGCTCACGAGGCCGACGAAGCTGACCGAGCAA
CAGGCCATCAACCAAGCCAAAGGCTTGGTGCGTATTCCGATGTGATGGAGTATCATGAAATTCCGTCGCT
GACCGCGGCCGAGATCAAGAACATCGGCGAACGCGTTGCTGGCGCGACGAACCAGTTCATCAGCCGAGCA
AACCCGATGCTCTCCGCAGCCTTGCCAACAGGGGAGCGAAGCCAAATCGTCCTACCGCCGGCAGCGGCCG
ACGGTGGCGCCATCTCGATCCGCAAGCAAACGCCGTCCAGCCGATGCGGCGCTTGGCGGCCTTGA
 Primer design