SecReT4
Protein ID: 86359753
T4SS name [ID]VirB [18]
Gene symbolvirB7a
Locus tagRHE_PA00048
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]53156..53323 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDQ2K2E1
KEGG IDret:RHE_PA00048
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|86359753|ref|YP_471644.1| transport secretion system IV, VirB7 protein [Rhizobium etli CFN 42]
MKYCLLCLAIVLTGCQTNDKPASCKGPIFPLNVGRWQPAPSDLHPGMADGQHERV
 
Nucleotide Sequence: 168 bp     [Download]
>gi|86359705|ref|NC_007762.1|:53156-53323 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGAAATATTGCTTGCTGTGCTTGGCTATCGTTTTGACCGGTTGCCAGACGAATGACAAACCGGCGAGTT
GTAAAGGACCTATTTTCCCGCTGAATGTGGGACGATGGCAACCTGCGCCGTCAGATCTTCACCCGGGTAT
GGCGGATGGACAGCATGAAAGGGTCTGA
 Primer design