SecReT4
Protein ID: 86359754
T4SS name [ID]VirB [18]
Gene symbolvirB8a
Locus tagRHE_PA00049
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]53250..54023 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ2K2E0
KEGG IDret:RHE_PA00049
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.4e-40, Aligned region: 43..247
Protein Sequence: 257 a.a.     [Download]
>gi|86359754|ref|YP_471645.1| transport secretion system IV, VirB8 protein [Rhizobium etli CFN 42]
MWDDGNLRRQIFTRVWRMDSMKGSDYALLVGREKLAEHYKEVEAFQTARAKSARRLSRVAAVVAAVATLG
NVAQAFTIATMVPLTRLVPVYLWIRPDGTVDSEVSVSRLPATQEKAVVNASLWEYVRMRESYTADTAQYA
YDLVSNFSAPAVRQDYQQFFNYPNPGSPQVVVGKRGRLEVEHIASNDVAPGVQEIRYKRTLVIDSKMPVV
STWTATIHYEKVNSLPGRLRLTNPGGLVITSYQTSEDTVSNAGAGEP
 
Nucleotide Sequence: 774 bp     [Download]
>gi|86359705|ref|NC_007762.1|:53250-54023 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGTGGGACGATGGCAACCTGCGCCGTCAGATCTTCACCCGGGTATGGCGGATGGACAGCATGAAAGGGT
CTGACTATGCGCTGCTGGTAGGGCGGGAAAAGCTGGCCGAGCACTACAAGGAAGTGGAGGCTTTTCAAAC
CGCACGTGCGAAATCGGCGCGACGTCTCTCCAGAGTGGCTGCGGTTGTCGCAGCCGTCGCAACCTTGGGC
AATGTCGCTCAAGCGTTCACGATTGCCACAATGGTACCGCTGACAAGGCTTGTGCCGGTGTATCTGTGGA
TCCGGCCGGACGGCACAGTGGACAGCGAGGTATCCGTCTCGCGCTTGCCTGCCACCCAGGAAAAAGCCGT
CGTCAACGCCTCATTGTGGGAGTATGTCCGGATGCGCGAGAGTTACACCGCTGATACTGCCCAGTACGCC
TATGATCTGGTCTCGAACTTCAGCGCCCCGGCGGTGCGCCAGGATTACCAGCAGTTCTTCAATTATCCCA
ATCCAGGTTCACCTCAGGTCGTCGTCGGAAAACGCGGCAGGCTGGAGGTTGAGCACATTGCTTCGAACGA
TGTAGCGCCGGGTGTGCAGGAAATTCGCTACAAACGGACCCTCGTCATCGACAGCAAAATGCCGGTGGTG
AGTACGTGGACCGCAACAATTCACTACGAAAAGGTGAACAGCCTGCCCGGCAGATTAAGGCTTACCAATC
CGGGAGGTTTGGTCATCACATCATACCAGACATCCGAAGATACCGTTTCCAACGCGGGCGCCGGCGAACC
ATGA
 Primer design