SecReT4
Protein ID: 86359757
T4SS name [ID]VirB [18]
Gene symbolvirB11a
Locus tagRHE_PA00052
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]56042..57076 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ2K2E2
KEGG IDret:RHE_PA00052
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.8e-56, Aligned region: 13..310
Protein Sequence: 344 a.a.     [Download]
>gi|86359757|ref|YP_471648.1| transport secretion system IV, VirB11 protein [Rhizobium etli CFN 42]
MEVNTQLRFLLNPVLEWLDDPRTEEVAINRPGEAFLRQGGIFTKMSLPLSYNDLEDIAILAGALRKQDVG
PRNPLCATELPGGERLQICLPPAVLAGTVSLTIRRPASHVSGLNGVTDRYDVSRWNQWERRKRRRDQQDE
TILRHYDSGDLEAFLHACVVGRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHENHVR
LLYAKNAGGPDAVTAEHLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSSQGAGLEDRTLIDMLSSAIDVIIPFRAYGDIYEVEEIWLAADARRRGEAIGDLLDQH
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|86359705|ref|NC_007762.1|:56042-57076 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGGAGGTCAATACGCAGCTGCGATTTCTTCTCAATCCGGTTTTGGAATGGCTCGACGACCCGAGGACCG
AAGAGGTTGCGATAAATCGACCTGGCGAGGCATTTCTGCGCCAGGGCGGCATCTTCACCAAAATGTCCCT
GCCTCTGTCATACAACGATCTCGAAGATATCGCCATTCTGGCAGGCGCATTGAGAAAGCAGGATGTCGGA
CCACGAAATCCCCTTTGCGCCACTGAACTTCCGGGTGGTGAGCGGCTGCAAATTTGCCTGCCGCCCGCTG
TCCTGGCGGGCACTGTGAGCTTGACGATTCGACGGCCAGCTTCCCATGTTTCCGGTCTCAACGGGGTTAC
GGACCGTTACGATGTTTCAAGATGGAACCAGTGGGAGAGGCGAAAAAGGCGCCGGGATCAACAGGATGAA
ACTATCCTCAGGCACTACGACAGCGGCGATCTGGAGGCATTTCTGCATGCATGCGTCGTGGGTCGGTTGA
CGATGCTGCTTTGCGGCCCAACCGGGAGCGGCAAGACGACGATGAGCAAGACTCTGATCAGTGCAATCCC
GCCGCAGGAACGGCTGATCACAATCGAGGATACCCTCGAACTCGTCATTCCACATGAGAACCACGTCCGG
CTGCTCTATGCAAAAAATGCGGGCGGACCGGACGCTGTAACCGCCGAGCACCTGCTGCAGGCCAGTCTGC
GCATGCGGCCGGACCGGATTCTTCTCGGAGAGATGCGTGACGACGCGGCATGGGCCTATCTGAGTGAAGT
CGTCTCAGGGCATCCGGGATCGATTTCCACCATACACGGCGCCAATCCTGTTCAGGGGTTCAAGAAACTG
TTTTCACTGGTGAAAAGCAGCTCGCAGGGCGCTGGCCTGGAAGATAGAACACTGATCGACATGCTTTCGA
GCGCGATTGATGTCATCATACCCTTTCGAGCCTACGGCGACATTTACGAGGTGGAAGAAATCTGGCTCGC
CGCTGATGCGCGCCGTCGGGGAGAGGCGATTGGCGATCTTCTGGATCAGCACTAG
 Primer design