SecReT4
Protein ID: 86359771
T4SS name [ID]VirB [18]
Gene symbolvirD4
Locus tagRHE_PA00070
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]75279..77279 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDQ2K2F8
KEGG IDret:RHE_PA00070
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.4e-157, Aligned region: 97..538
TraG-D_C [PF12696], Evalue: 2.4e-28, Aligned region: 391..508
TrwB_AAD_bind [PF10412], Evalue: 2.8e-23, Aligned region: 138..520
AAA_10 [PF12846], Evalue: 4.7e-09, Aligned region: 140..467
Protein Sequence: 666 a.a.     [Download]
>gi|86359771|ref|YP_471662.1| transport secretion system IV, VirD4 protein [Rhizobium etli CFN 42]
MNSSKSTPLRLAVSVVCSLAAGLCVASLYVTFRQGFNGEAMMTFSVFAIWYESPLYLGHTTSVFYYALAI
VVSTSAVVLLSQLFVSLRNREHHGTARWAEFGEMRRAGYLQRYTSINGAVFGKTCGPHWFGSYLTNGEQP
HSLVVAPTRAGKGVGVVIPTLLTFRGSVIALDVKGELFDLTSRARKANGNVVFKFAPLDPERRTHCYNPV
LDIAAMPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILACIERGTPTIGAVYDLFAQPGEKY
KLFAQLAEESQNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSIYDLRRRKTC
VYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPGKDERYEVLFLLDEFRHLGKLEAIETAITTIAGYNGR
FMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFKARSTSYNQTRMFDQNI
QISDQGAPLLRPEQVRLIDDRNEIILIKGHPPLKLRKVQYYSDRALKRIFEAQTGSLPEPAPLVLPENIN
RGDLEQPTVLAAAREPGDKDFVGDNAETDGYNGNCNHDNDGAIGFDIPYGPIEIDDLEEYASTACVTADA
GPSAEVAPALVAQEQLLKRIIALQQRYRSGSSNPGD
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|86359705|ref|NC_007762.1|:75279-77279 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGAACTCGAGCAAGAGCACGCCCCTACGTTTGGCCGTTAGTGTCGTATGCTCGCTGGCAGCCGGTCTTT
GTGTTGCAAGCTTGTATGTAACGTTCCGCCAAGGCTTTAATGGCGAAGCGATGATGACCTTCAGTGTCTT
CGCCATCTGGTACGAGTCGCCGCTCTATCTGGGGCATACGACCTCGGTATTCTACTACGCTCTGGCCATT
GTCGTATCAACTTCAGCCGTCGTTCTACTCAGCCAACTGTTCGTGTCGCTGCGCAACCGCGAGCATCATG
GAACGGCTCGCTGGGCAGAATTCGGGGAAATGCGACGTGCCGGCTACCTGCAGCGTTACACCAGTATCAA
TGGTGCGGTGTTTGGCAAGACCTGTGGTCCCCACTGGTTCGGCAGCTATCTGACCAACGGCGAACAGCCC
CATAGTCTGGTCGTCGCGCCGACGCGAGCCGGCAAGGGCGTCGGCGTCGTCATTCCGACGCTGCTGACCT
TCAGGGGCTCGGTGATAGCACTCGATGTCAAAGGTGAGCTTTTTGACCTGACGTCCAGGGCACGAAAGGC
AAACGGCAACGTCGTTTTCAAGTTCGCGCCTCTGGATCCGGAGCGACGGACCCATTGCTACAATCCGGTT
CTCGATATTGCGGCAATGCCTCCCGAGAGGCAGTTTACCGAGACACGCCGACTTGCTGCAAACCTTATCA
CTGCGAAAGGCAAGGGAGCGGAAGGCTTCATCGATGGCGCACGAGACCTTTTTGTTGCGGGTATCCTTGC
TTGTATCGAGCGCGGCACTCCGACAATAGGCGCAGTCTACGACCTTTTTGCCCAGCCTGGCGAGAAGTAC
AAGCTTTTTGCGCAACTCGCGGAAGAAAGCCAGAATAAGGAGGCTCAGCGCATCTTTGACAACATGGCGG
GCAACGACACGAAAATCCTAACCTCCTATACGTCGGTGCTCGGCGACGGCGGTCTCAATCTTTGGGCTGA
TCCGCTGGTCAAGGCAGCGACCAGCCGATCCGACTTTTCCATCTACGACCTGCGTCGCAGGAAGACCTGC
GTTTATCTTTGTGTAAGTCCCAACGATCTTGAGGTCGTTGCGCCGTTGATGCGCCTTCTTTTTCAGCAGG
TCGTGTCGATTTTGCAGCGATCCCTGCCAGGGAAGGACGAGCGCTACGAAGTTCTGTTTCTCCTCGACGA
ATTCAGGCATCTGGGCAAACTTGAGGCCATCGAGACCGCGATCACCACCATCGCCGGATACAATGGCCGT
TTCATGTTTATTATTCAGAGTCTCTCCGCGCTGACGGGTACCTACGACGAGGCGGGCAAACAGAACTTTC
TCAGCAATACCGGTGTGCAGGTATTTATGGCCACCGCTGACGACGAAACACCGACATATATCTCGAAGGC
TATCGGGGAATATACGTTCAAGGCGCGCTCGACCTCCTATAATCAGACACGCATGTTCGACCAGAACATC
CAGATCTCCGATCAGGGGGCACCGCTTTTGCGCCCCGAACAGGTGCGCTTGATCGACGACAGGAATGAAA
TCATCCTCATAAAGGGGCACCCGCCACTTAAACTGCGAAAAGTGCAATATTACTCGGATCGCGCGCTGAA
GCGTATTTTCGAAGCCCAGACCGGTTCGCTCCCCGAGCCAGCGCCCCTTGTGCTGCCGGAGAACATCAAT
CGCGGAGACCTGGAACAGCCGACTGTCCTCGCGGCGGCGCGAGAGCCCGGCGACAAGGATTTTGTAGGCG
ACAATGCGGAAACCGATGGGTACAACGGCAACTGCAATCACGACAACGATGGGGCCATCGGATTTGATAT
CCCGTACGGCCCGATTGAAATCGACGATCTGGAGGAATACGCCAGCACAGCTTGTGTCACCGCCGATGCC
GGCCCGTCTGCCGAAGTCGCTCCGGCTCTGGTTGCGCAAGAACAATTGCTGAAACGGATAATCGCGCTTC
AGCAACGGTATAGGTCTGGCTCGTCAAACCCCGGGGATTGA
 Primer design