SecReT4
Protein ID: 86359869
T4SS name [ID]Trb [237]
Gene symboltrbG
Locus tagRHE_PA00171
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]181731..182543 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ2K2Q4, Q84HS9
KEGG IDret:RHE_PA00171
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-57, Aligned region: 57..268
Protein Sequence: 270 a.a.     [Download]
>gi|86359869|ref|YP_471760.1| conjugal transfer protein G [Rhizobium etli CFN 42]
MHRTGLIAAAGCLAGLVFVGGAEAQSMTNNEVKGTNISRKWRGTSGLVTTGPDGKVIFLFGETQPSVVCS
PLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGATGGQAIHLIVKPSEPGLVTSMVVTTSRRTYHIQLK
SHPSQYMARVGFEYPEDVSTKLADINSRLETGGISGTAPDKLNFSYSVNGSASWKPKRVYSDGMKTYIQF
SKSVSSQDAPVLFVVSGGQNRIVNYRMKNDMMIVDYAIDKAILVSGVGWRQQKITIRRGG
 
Nucleotide Sequence: 813 bp     [Download]
>gi|86359705|ref|NC_007762.1|:c182543-181731 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGCACAGAACAGGATTGATCGCAGCCGCCGGCTGCCTGGCCGGGCTCGTCTTTGTCGGGGGCGCTGAGG
CGCAGAGCATGACGAACAACGAGGTGAAGGGGACGAACATCTCCAGGAAGTGGCGTGGGACGTCAGGGCT
GGTGACGACCGGCCCCGATGGCAAGGTCATCTTCCTCTTTGGCGAAACGCAGCCGTCGGTCGTCTGCTCG
CCGCTGCAGGTCTGTGATATCGAATTGCAAGGTGGCGAAATCGTCCGCGATGTCTTGGTTGGAGACACCG
TGCGGTGGAAGGTGGAACCGGCGACCTCGGGCGCCACCGGCGGGCAGGCGATCCACCTGATCGTCAAACC
ATCGGAACCGGGGCTCGTCACCTCGATGGTGGTCACGACATCGCGCCGCACCTATCATATTCAACTCAAG
TCTCATCCGAGCCAATATATGGCCCGCGTCGGCTTCGAGTACCCGGAGGACGTCTCGACCAAGCTCGCCG
ATATCAATTCCCGGCTCGAGACCGGCGGCATCTCCGGGACGGCACCTGACAAACTGAACTTCTCCTACTC
GGTGAACGGCAGCGCGTCCTGGAAGCCGAAGCGTGTCTATTCGGATGGTATGAAAACATACATTCAATTC
TCGAAATCAGTCTCGAGCCAGGATGCACCGGTGCTCTTCGTCGTCAGCGGCGGTCAGAACCGCATCGTCA
ACTACAGGATGAAGAACGACATGATGATCGTCGACTACGCGATCGACAAAGCGATCCTCGTCTCCGGCGT
CGGCTGGCGTCAGCAAAAAATCACCATCCGGCGGGGAGGCTGA
 Primer design