SecReT4
Protein ID: 86359871
T4SS name [ID]Trb [237]
Gene symboltrbL
Locus tagRHE_PA00173
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]183248..184666 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ2K2Q7
KEGG IDret:RHE_PA00173
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.3e-32, Aligned region: 143..357
Protein Sequence: 472 a.a.     [Download]
>gi|86359871|ref|YP_471762.1| conjugal transfer protein L [Rhizobium etli CFN 42]
MPRSRAFPKVRRWSPAGEPRRCHCRARACGSFLLSGDRADRQFQGIQQACARRRTTHRQGEVLRLEHGAA
ADQGRPGDAPKMVKRTLEQSFLIAGLLCLVFAAPAFAQQGQVLTELENQVSTAAKGWETTIMDAAKSLFW
ILATIEVGIAAVWLALQAASLDSWFAELVRRIMFIGFFAFVLTQGPTFARAVVDSLFQIGAGGGSASPAE
VFDAGIRVASQMSQQAQFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGG
SSFTKDFAVRYLVYAFGVGMKLMALVMIAKIGSEVLMGLANAPTASSDQFVTTLAIAGISVVVFIIAMYV
PNIIQGVVQGASVSGGMEAIRHGGQAASFATGAGFLAAGATGAGFAAGQSARAAGSSVAGAMLRGFGAGI
GSAGKAAGSAAKEKAIGSPGAYAGSILGLANSKLDQARSGQSGPKSPPERKD
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|86359705|ref|NC_007762.1|:c184666-183248 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGCCGAGATCAAGAGCATTCCCGAAGGTCAGAAGATGGAGCCCCGCTGGTGAGCCGCGCCGTTGTCATT
GCCGTGCTCGCGCTTGTGGCAGCTTTCTCCTCAGCGGCGACCGTGCTGATCGTCAATTCCAAGGAATCCA
ACAAGCCTGCGCTCGCCGAAGAACAACGCACCGTCAGGGAGAAGTTCTTCGGCTCGAACATGGAGCCGCC
GCCGATCAAGGACGGCCAGGAGATGCGCCCAAGATGGTGAAACGCACCCTTGAACAATCGTTCCTGATCG
CTGGCCTCCTTTGCCTCGTCTTTGCAGCTCCTGCCTTCGCGCAACAGGGACAAGTCCTGACAGAACTAGA
AAATCAGGTTTCCACCGCCGCTAAAGGGTGGGAGACCACCATCATGGATGCGGCGAAATCTCTGTTCTGG
ATCCTGGCAACTATCGAGGTGGGCATTGCCGCGGTCTGGCTGGCGCTCCAGGCGGCCTCCCTCGACAGCT
GGTTTGCTGAGCTTGTCCGGCGCATCATGTTCATTGGCTTTTTCGCCTTTGTTCTCACGCAAGGGCCGAC
TTTTGCCCGAGCGGTCGTCGACAGCCTCTTCCAGATTGGCGCCGGCGGCGGATCCGCGTCGCCCGCCGAA
GTGTTCGACGCAGGCATCCGGGTTGCCTCGCAAATGTCGCAGCAGGCACAATTCGGCGTGTTCGAGGACA
ATGCTTTGGCGATCGCGGCCGTGCTGGCGATGGGTGTCGTCGTCATCTGCTTCTCGCTGGTCGCAGCAAT
TTTCGTGTCGGTCATGGTCGAGATGTATGTCGGTCTGCTTGCCGGCATGATCATGCTCGGGCTGGGGGGA
TCCTCCTTTACCAAGGACTTTGCTGTCCGCTATCTCGTCTACGCCTTCGGCGTCGGCATGAAGCTGATGG
CGTTAGTCATGATCGCGAAGATCGGGTCCGAAGTCCTCATGGGTCTGGCAAACGCGCCAACTGCCTCCTC
GGACCAGTTCGTGACGACGCTCGCCATCGCCGGGATCTCGGTCGTGGTCTTCATCATCGCCATGTATGTG
CCGAACATCATTCAGGGTGTCGTTCAGGGCGCCTCCGTCTCGGGCGGCATGGAAGCAATCCGGCACGGTG
GGCAGGCGGCATCCTTCGCGACCGGCGCGGGTTTCCTCGCGGCCGGCGCGACGGGCGCAGGGTTCGCGGC
TGGTCAAAGCGCGCGGGCCGCAGGGTCCTCCGTTGCAGGAGCGATGCTCCGAGGTTTCGGCGCAGGGATC
GGCTCGGCAGGAAAAGCAGCGGGCTCGGCTGCCAAGGAGAAGGCCATCGGCTCTCCCGGCGCCTATGCCG
GGTCTATCCTGGGGCTCGCCAATTCCAAGCTCGATCAGGCGCGCAGCGGGCAAAGCGGACCAAAATCACC
TCCCGAACGCAAAGACTAA
 Primer design