SecReT4
Protein ID: 86359875
T4SS name [ID]Trb [237]
Gene symboltrbC
Locus tagRHE_PA00177
StrainRhizobium etli CFN 42
Repliconplasmid p42a [GenBank: NC_007762] [Browse all T4SS(s) in this replicon]
Location [Strand]188147..188530 [-]
Productconjugal transfer protein C
Component typeTrbC
UniProt IDQ84HS2, Q2K2R1
KEGG IDret:RHE_PA00177
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.3e-20, Aligned region: 4..99
Protein Sequence: 127 a.a.     [Download]
>gi|86359875|ref|YP_471766.1| conjugal transfer protein C [Rhizobium etli CFN 42]
MSRRNAVVAAVLLAAPIVLASVAPALASSGGSLPWEGPLQQIQESITGPVAGAIALAAVAIAGGMLIFGG
ELNDFARRLMYIVLVAGILLGATNIVGLFGATGASIGTPDEQTTSIGQSETGEGAHG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|86359705|ref|NC_007762.1|:c188530-188147 Rhizobium etli CFN 42 plasmid p42a, complete sequence
ATGTCGCGTAGGAACGCAGTCGTAGCCGCGGTACTCCTCGCGGCACCCATCGTCCTTGCCTCGGTCGCGC
CGGCGCTCGCCAGTTCCGGCGGCAGTCTTCCCTGGGAAGGACCGCTGCAGCAGATCCAGGAGTCGATCAC
CGGTCCGGTCGCGGGTGCCATTGCCCTTGCAGCGGTCGCAATCGCCGGCGGTATGCTGATCTTTGGCGGC
GAGCTGAACGATTTCGCGCGGCGGCTCATGTACATCGTGCTCGTCGCCGGCATCCTACTTGGGGCCACCA
ACATCGTCGGCCTATTCGGCGCGACGGGAGCTTCCATCGGAACTCCAGACGAGCAAACCACCTCAATCGG
TCAAAGCGAAACAGGGGAGGGGGCTCATGGCTGA
 Primer design