SecReT4
Protein ID: 86559558
T4SS name [ID]Tcp [634]
Gene symbol-
Locus tagpCPF4969_16
StrainClostridium perfringens CPE str. F4969 plasmid pCPF4969 (NC_007772)
Repliconplasmid pCPF4969 [GenBank: NC_007772] [Browse all T4SS(s) in this replicon]
Location [Strand]12791..13855 [+]
ProductDNA segregation ATPase FtsK/SpoIIIE
Component typeTcpA
UniProt IDQ2L5Y4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 8.7e-27, Aligned region: 34..197
AAA_10 [PF12846], Evalue: 6e-14, Aligned region: 45..99
AAA_10 [PF12846], Evalue: 6e-14, Aligned region: 140..224
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 34..75
Protein Sequence: 354 a.a.     [Download]
>gi|86559558|ref|YP_473379.1| DNA segregation ATPase FtsK/SpoIIIE [Clostridium perfringens CPE str. F4969]
MKSMSGSLEIEEKIPWSDEYIEPQEGVVCIGESETQKIKIDLNKSPHLLSAGETGSGKSVIVRCILWQLI
SQGAIAYMVDFKGGVEFGLQYEKIGQVITEVDQAEALFAFLVEENSRRLKLLRENQVKNIAEYNAKCSGS
LRRIVVVIDELAELMDKTGVDDEKKEKLTKIEGYLSTLARLSRATGINLLIATQRPDAKVITGQIKNNVP
VRICGRFADAKASEIVLSNTKAKDLDPIKGRFLFKLGADTIEFQAYYFDDDKHFIPSKIFKVREAFKDNE
NKNNLIDEGSNENKTIENNAKEIINLVKEKVEVNNEEKKTEVNIIKEDVEVKNDEISEKSKGEKFNNIGK
FDYE
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|86559543|ref|NC_007772.1|:12791-13855 Clostridium perfringens CPE str. F4969 plasmid pCPF4969, complete sequence
ATGAAATCAATGAGTGGTTCTCTTGAAATTGAGGAAAAAATTCCGTGGAGTGATGAGTATATAGAACCAC
AAGAAGGTGTTGTTTGCATTGGAGAGTCTGAAACTCAAAAGATAAAAATTGATTTAAATAAAAGTCCACA
TTTACTATCTGCAGGTGAAACAGGATCAGGTAAATCTGTAATTGTTAGATGTATTCTTTGGCAACTTATA
AGCCAAGGAGCAATAGCCTATATGGTCGATTTTAAAGGAGGAGTGGAATTTGGTTTACAGTATGAAAAAA
TAGGTCAAGTAATAACTGAAGTTGATCAAGCAGAAGCTCTTTTTGCTTTCCTTGTTGAAGAAAATTCTAG
ACGTTTAAAGTTATTAAGAGAAAATCAAGTTAAAAATATTGCTGAATATAATGCAAAGTGCTCAGGAAGT
TTAAGAAGAATTGTTGTTGTAATTGATGAACTTGCAGAGCTTATGGATAAAACCGGAGTAGATGATGAAA
AGAAAGAAAAATTAACAAAAATAGAAGGTTATTTATCTACTTTAGCTCGTCTATCTAGAGCTACAGGTAT
AAATCTATTAATTGCTACTCAAAGACCAGATGCAAAAGTAATTACAGGACAAATTAAGAATAATGTTCCT
GTTAGAATATGTGGTCGTTTTGCAGATGCAAAGGCATCTGAAATTGTATTAAGTAATACTAAAGCTAAGG
ATTTAGATCCAATAAAGGGACGTTTCTTATTTAAACTTGGAGCCGATACAATTGAATTTCAAGCTTATTA
TTTTGATGATGATAAACATTTTATTCCTAGTAAGATTTTTAAAGTTAGAGAAGCTTTTAAGGATAATGAA
AATAAAAATAATCTAATTGATGAAGGTTCAAATGAAAATAAAACCATAGAGAATAATGCTAAAGAAATTA
TAAATTTAGTTAAAGAAAAAGTAGAAGTTAATAATGAGGAAAAGAAAACTGAAGTTAACATTATCAAAGA
AGATGTTGAAGTTAAAAATGATGAGATAAGTGAAAAAAGCAAAGGTGAAAAATTTAATAATATAGGGAAG
TTTGATTATGAATAG
 Primer design