SecReT4
Protein ID: 86559567
T4SS name [ID]Tcp [634]
Gene symbol-
Locus tagpCPF4969_25
StrainClostridium perfringens CPE str. F4969 plasmid pCPF4969 (NC_007772)
Repliconplasmid pCPF4969 [GenBank: NC_007772] [Browse all T4SS(s) in this replicon]
Location [Strand]22953..23957 [+]
Productputative muramidase
Component typeTcpG
UniProt IDQ2L5X5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 1.8e-41, Aligned region: 54..188
NLPC_P60 [PF00877], Evalue: 1.7e-27, Aligned region: 218..328
Protein Sequence: 334 a.a.     [Download]
>gi|86559567|ref|YP_473388.1| putative muramidase [Clostridium perfringens CPE str. F4969]
MKKLFIWSGIISLIFPLLFFFLIIGGSGEQPTPVNPNPNLTEEQLNFISQIVSGAKQSYEETGIFPSITL
AQAILESGWGRSGLAIKANNLFGIKADSGWKGKVLEMPTQEHVNGGIITIIARWRVYESWNESVIDHGKF
FVENSRYKENGVLDAKNYVEQAQCIQKAGYATDPNYANQLIQVINDFGLNLYDMNGDIVGNDVIEKAIEA
GMKWVGKSPYVWGGGRNQADVDAGRFDCSSLVHYCYASAGITLGPRESVTTWSLINMGKPVPASEMKRGD
LIFFDTAGRNGHIGIYLGNGKFLNDSSTQGVSIGDLNSAYWSRYFNGNVRRVVE
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|86559543|ref|NC_007772.1|:22953-23957 Clostridium perfringens CPE str. F4969 plasmid pCPF4969, complete sequence
ATGAAAAAGCTTTTTATATGGAGTGGAATAATATCTTTGATATTTCCACTTCTATTTTTTTTCTTAATTA
TAGGGGGAAGTGGTGAACAGCCAACTCCAGTAAATCCTAATCCTAATTTAACGGAAGAGCAGCTTAATTT
TATAAGTCAGATTGTTTCCGGAGCGAAGCAATCCTATGAAGAAACAGGAATATTTCCATCAATAACCCTG
GCACAAGCTATATTAGAAAGTGGTTGGGGAAGATCTGGGTTGGCCATAAAAGCTAATAATTTATTTGGTA
TAAAAGCTGACTCTGGATGGAAGGGGAAAGTTTTAGAAATGCCAACTCAGGAGCATGTTAATGGTGGAAT
AATAACTATTATAGCAAGGTGGAGAGTTTACGAAAGCTGGAATGAATCTGTAATAGATCATGGTAAATTC
TTTGTAGAAAATTCTAGATATAAAGAAAATGGAGTCTTGGATGCAAAAAATTATGTAGAGCAAGCTCAGT
GCATACAAAAAGCGGGTTATGCAACAGATCCAAACTATGCAAACCAATTAATCCAGGTAATAAATGATTT
TGGGCTAAATCTTTACGATATGAACGGAGATATTGTAGGGAATGATGTTATAGAAAAAGCAATAGAAGCT
GGAATGAAGTGGGTTGGTAAATCTCCATATGTTTGGGGAGGCGGTCGTAACCAAGCTGACGTTGATGCAG
GACGATTTGATTGTAGTTCCTTAGTACATTATTGTTATGCATCTGCAGGAATAACTTTAGGGCCAAGAGA
AAGTGTAACCACATGGTCATTAATAAACATGGGTAAACCTGTACCTGCAAGTGAAATGAAGCGTGGGGAC
TTAATATTCTTCGATACTGCTGGAAGGAACGGCCATATCGGCATCTACCTTGGAAATGGTAAATTCCTAA
ATGATAGTTCTACTCAAGGAGTAAGTATTGGAGACCTAAATAGTGCTTATTGGAGCAGATATTTTAACGG
AAATGTAAGAAGAGTCGTAGAATAA
 Primer design