SecReT4
Protein ID: 87160106
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1484
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1639910..1640293 [-]
Producthypothetical protein
Component typeYddD
UniProt IDQ2FGJ9
KEGG IDsaa:SAUSA300_1484
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.1e-20, Aligned region: 7..111
Protein Sequence: 127 a.a.     [Download]
>gi|87160106|ref|YP_494179.1| hypothetical protein SAUSA300_1484 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MDKKAYNLKRTFEQPIVMYEFTDKFRINKGFRLDFWATFLIVWFILFLLFWYLLQPVIMSIGGLMFIYFT
VAPYYITKYIVKLKQDGKKLFFFLWDFVIFVFNVQLRKVKLSYDEEVEYHDKKITFK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1640293-1639910 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
TTGGATAAAAAAGCTTATAATTTAAAGCGAACTTTTGAACAACCGATAGTTATGTATGAATTTACAGATA
AGTTTCGTATTAATAAGGGTTTTCGTTTAGATTTTTGGGCTACATTTTTGATTGTGTGGTTTATATTATT
TTTGTTATTTTGGTATTTATTACAGCCTGTAATTATGTCGATTGGTGGACTTATGTTTATTTACTTTACG
GTTGCACCTTATTATATAACGAAATATATTGTTAAGTTAAAACAAGATGGAAAGAAATTATTTTTCTTCT
TATGGGATTTTGTAATATTTGTTTTTAATGTGCAGTTAAGAAAAGTTAAATTAAGTTATGATGAAGAAGT
AGAATATCATGATAAAAAAATAACATTTAAATAG
 Primer design