SecReT4
Protein ID: 87160603
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1481
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1634116..1635963 [-]
Producthypothetical protein
Component typeYddG
UniProt IDQ2FGK2
KEGG IDsaa:SAUSA300_1481
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 615 a.a.     [Download]
>gi|87160603|ref|YP_494176.1| hypothetical protein SAUSA300_1481 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MKHKSVYLLCFLILPILLLTSVSAYAVSNPVGEPSHAVKPKIEKYDLSHYRSIYSEKGDWNPFGQEEISR
QINNVSDFFFSMTKILAGVTDYAIENLFQLDVINDFADKIGDFVGDIYQKLLSNLALTLFIIVCFNAFII
FSVQGNAREALKRAFLIMCLIGFGVGILANAGNIIRGTNNIGKDLNNIIMNSTSSIDGNIDYIHENSGMN
HIRNQLFDMTIYRTYLVMNYGTVDEKEIKAKGKDRIDNILKLDYDKKSEKELDDIVKDEVEKKNNKYMTQ
GYVFQKLAISVIGFIITLFMSIVFLSISFAKLIFSTFALFLFLFLVFSWIVSFIPGFELSVFSAFAKTLG
YIILSACMTFLFVIVGLCIKLANSFIEPDSQNAYFLNSIFIIVILFVMYKKRAQIINFVSRGNISFSPSA
IGAGVMNRTQERFNKIRHEQAQNKKAKRENQRDEPAPPLQNDNDLRRRQQDKPMPLFINKDNQKNGNKRR
EQQESMNGNDVKSASVESNANNYSKQPQKASQQEHQVRETRQRKDIQRSPQVVNQPLNNENHSINRKEQK
SVQTAYDTDVQKRQIQNATQNQQSRQSGNRNQPITRNSQSKDRLKEQKDINKHGK
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1635963-1634116 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
ATGAAGCATAAAAGTGTGTATCTTTTATGCTTTTTAATTTTGCCTATTCTGCTTTTAACATCTGTGAGTG
CTTATGCTGTTTCTAATCCAGTTGGAGAGCCCTCACATGCAGTTAAGCCAAAAATTGAAAAGTATGATTT
ATCACATTATCGTTCAATATATAGTGAAAAAGGCGACTGGAATCCGTTTGGTCAAGAAGAAATTTCACGT
CAAATTAATAATGTGTCAGATTTTTTCTTTTCTATGACTAAGATTTTAGCAGGTGTTACAGATTATGCGA
TTGAAAATTTATTTCAATTAGATGTTATTAATGATTTTGCGGATAAAATCGGCGATTTTGTTGGCGATAT
ATATCAAAAGTTATTGAGTAATTTAGCATTAACATTATTTATTATTGTTTGTTTTAACGCATTTATTATT
TTTAGTGTACAAGGTAATGCAAGAGAAGCATTAAAACGAGCGTTTTTAATTATGTGTTTAATTGGTTTTG
GTGTTGGTATACTTGCGAATGCAGGTAATATTATACGTGGTACAAACAATATTGGTAAGGACTTAAATAA
TATAATTATGAATAGTACATCTTCTATTGATGGTAATATTGATTATATTCATGAGAATTCAGGTATGAAT
CATATACGTAATCAATTATTTGATATGACGATATATAGAACATATTTAGTAATGAATTATGGAACTGTCG
ACGAAAAAGAGATAAAAGCAAAAGGTAAAGACCGTATTGATAACATTTTAAAACTTGATTATGATAAAAA
ATCAGAAAAAGAATTAGATGATATTGTTAAAGATGAGGTTGAAAAGAAAAATAATAAATATATGACGCAA
GGTTATGTATTTCAAAAGTTGGCTATTTCAGTGATTGGTTTTATTATTACACTTTTTATGTCGATAGTAT
TTTTATCAATAAGTTTTGCGAAGTTGATTTTTTCTACATTTGCTTTATTTTTATTCTTATTTTTAGTATT
CAGTTGGATAGTGAGTTTTATACCAGGATTTGAATTATCTGTTTTCTCTGCGTTTGCAAAAACGTTAGGC
TATATTATTTTAAGTGCTTGTATGACATTCTTATTTGTGATAGTTGGTTTGTGTATCAAGCTTGCAAATA
GTTTTATTGAACCGGATAGTCAAAATGCTTATTTTTTAAATTCAATATTTATAATTGTAATATTGTTTGT
AATGTATAAAAAACGGGCTCAAATTATCAATTTTGTAAGTCGTGGTAATATTAGTTTTTCTCCTAGTGCA
ATTGGTGCTGGTGTGATGAATCGAACACAAGAACGTTTTAATAAGATTCGTCATGAACAAGCGCAAAATA
AGAAAGCTAAACGAGAAAATCAAAGAGATGAACCCGCCCCACCACTTCAAAATGATAATGATTTAAGAAG
AAGACAACAGGATAAACCAATGCCTTTATTTATAAATAAAGATAATCAAAAAAATGGTAATAAGCGCAGA
GAACAACAAGAGTCAATGAATGGTAACGATGTAAAATCTGCTTCTGTTGAATCAAATGCAAATAATTATT
CTAAACAACCACAAAAAGCATCACAGCAAGAACATCAAGTACGAGAAACAAGACAGCGAAAAGATATACA
AAGGTCGCCACAAGTGGTTAATCAGCCATTAAATAATGAGAATCATTCAATAAATCGTAAAGAACAGAAG
TCAGTTCAAACTGCTTATGATACTGATGTTCAAAAACGACAAATACAAAATGCGACACAGAATCAACAAA
GTAGACAATCTGGAAATCGTAATCAACCTATTACGCGTAATTCTCAGTCAAAAGACCGTTTAAAAGAGCA
AAAGGATATCAATAAGCATGGTAAATAA
 Primer design