SecReT4
Protein ID: 87161147
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1486
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1640570..1641625 [-]
Producthypothetical protein
Component typeYddB
UniProt IDQ2FGJ7
KEGG IDsaa:SAUSA300_1486
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 7.9e-48, Aligned region: 98..343
Protein Sequence: 351 a.a.     [Download]
>gi|87161147|ref|YP_494181.1| hypothetical protein SAUSA300_1486 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MKIISKYILTRFSKNGKHFDIPKEQRRVIPKFKNRRKMIVICFYSLLAILLILLLASFIKATRANNDSKE
AVNKTNMIQKKYEDNANTVQYSPKLKLYADKFIDTYMNISKDSKELESREKELLKYFPSDYKKPDEKISD
TERKLNSKEFYNIKRKDKQTIIQYIVNYDVNITEKKEVKVKKKKKSEKDKDEYETKTEEKQRKVNQNILI
NIPIKSENNKYVVVEYPYFTPIPDSQLNQAKMVEDNLKDNKREDNPKAKAFIEDFFNKYASSKSDDMAYL
MDNPEGLEGTREVSQIREIRLYPKGDDYVAKVEILMKDKDSPLENLEHYTLDITKKDGKYYVKNMTNSIG
G
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1641625-1640570 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
ATGAAAATAATAAGCAAGTACATTTTAACACGATTTTCTAAAAACGGAAAGCATTTTGATATTCCTAAAG
AACAACGCCGAGTAATTCCAAAATTTAAAAATCGTCGTAAGATGATTGTAATTTGTTTTTACTCATTATT
AGCTATTTTGTTAATTCTTTTATTAGCTTCTTTTATTAAAGCTACAAGAGCAAATAATGACAGTAAAGAA
GCAGTTAATAAAACGAATATGATTCAAAAAAAGTATGAAGATAATGCGAATACAGTTCAGTATAGTCCTA
AATTAAAGTTATATGCTGATAAGTTTATTGATACGTATATGAATATCTCGAAAGATTCAAAAGAATTGGA
ATCTAGAGAAAAAGAATTGTTGAAATATTTTCCATCAGATTATAAAAAACCTGATGAAAAAATTTCAGAT
ACAGAACGAAAATTGAATAGTAAAGAATTTTATAATATTAAACGTAAAGATAAACAAACAATTATACAGT
ATATTGTTAATTATGATGTGAATATTACTGAAAAGAAAGAAGTTAAAGTTAAGAAGAAAAAGAAAAGTGA
AAAAGATAAAGATGAGTATGAAACAAAAACAGAAGAAAAGCAACGTAAAGTAAATCAAAACATTTTAATA
AATATACCTATTAAGAGTGAAAATAATAAGTATGTTGTTGTTGAATATCCTTATTTTACGCCAATCCCTG
ATAGTCAATTGAATCAAGCTAAAATGGTTGAGGATAATTTGAAAGACAATAAACGGGAAGACAATCCGAA
AGCAAAAGCTTTTATTGAAGATTTCTTTAATAAATATGCTTCTAGTAAGTCTGATGATATGGCCTATTTA
ATGGATAACCCTGAGGGCTTAGAAGGAACTAGAGAAGTTTCTCAGATAAGAGAAATTAGGTTATATCCAA
AAGGCGATGATTATGTTGCTAAAGTTGAAATTTTGATGAAAGATAAAGATTCTCCTTTGGAGAATTTGGA
GCATTACACATTAGATATAACAAAAAAAGATGGTAAATATTACGTTAAAAATATGACTAATTCTATTGGA
GGTTAA
 Primer design