SecReT4
Protein ID: 87161179
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1482
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1635968..1637326 [-]
ProductFtsK/SpoIIIE family protein
Component typeYdcQ
UniProt IDQ2FGK1
KEGG IDsaa:SAUSA300_1482
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.1e-23, Aligned region: 209..369
Protein Sequence: 452 a.a.     [Download]
>gi|87161179|ref|YP_494177.1| FtsK/SpoIIIE family protein [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MAMNEIALFKGVRIQPYQKYIDFMFASVLAFIFLVYRIYILFIDYKSVNKKLDILTLFAYFKPHLLYLLI
GTAIIFVICKLIAQFLIRFKTKDLAEMIETQGFHNRTVIKKTTEYIPIDYKQTEYDYYPTMFYKRGKKSF
VIHIKKDGSRFQDNYLELETIIEPMFNSELVEKKHIGRYLRYEFMPLKYKKRIVMNGEQESNTIFYDTKI
AITHQITWDFVKAPHGLVTGITGGGKTYFLFYVIRELFRRHSEVRLLDPKVSDLSFMKRVIGDDKVADTK
GQILKQLREANNEMEERFRLMNDSSDYKIGNDFRNFDMRPYFIIFDEVTAFTSTLDKKELQEMNDYLINI
IMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSLGNLSNDGYRMTFGQTDKEFQTIHDSDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKE
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1637326-1635968 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
ATGGCAATGAATGAAATTGCTTTATTTAAAGGCGTACGTATACAGCCTTATCAGAAGTATATTGATTTTA
TGTTTGCAAGTGTATTAGCATTTATTTTTTTGGTATATCGTATATATATTTTGTTTATTGATTATAAATC
AGTTAATAAAAAATTGGATATATTGACGTTGTTTGCATATTTTAAACCGCATTTATTGTATTTATTAATT
GGTACAGCAATTATATTTGTGATATGTAAGCTTATTGCTCAGTTTTTAATACGTTTTAAAACAAAAGATT
TGGCTGAAATGATTGAAACACAAGGTTTTCATAATCGTACAGTAATCAAGAAAACAACTGAGTATATCCC
TATTGATTATAAACAAACTGAATATGATTATTATCCAACAATGTTTTATAAGCGTGGTAAAAAATCTTTT
GTTATTCATATTAAGAAAGACGGTTCGAGGTTTCAAGATAATTATTTAGAGTTAGAGACGATTATTGAAC
CAATGTTTAATTCTGAATTAGTAGAAAAAAAGCATATTGGTCGTTATTTGAGATATGAATTTATGCCACT
TAAATATAAAAAGCGTATTGTTATGAATGGCGAACAAGAATCAAATACAATTTTTTATGATACAAAAATT
GCTATTACGCATCAAATTACTTGGGATTTTGTGAAAGCACCTCATGGATTGGTTACAGGTATAACCGGAG
GTGGTAAAACATATTTTTTATTTTATGTGATTCGTGAGTTATTCCGTAGACATTCAGAAGTACGTTTATT
AGACCCAAAAGTTTCAGATTTGAGCTTTATGAAGCGCGTTATTGGTGATGATAAAGTTGCAGATACTAAA
GGTCAAATATTAAAACAATTGAGAGAAGCTAATAATGAAATGGAAGAGCGTTTTAGATTAATGAATGATA
GTTCGGATTATAAAATCGGGAATGATTTCCGTAATTTTGATATGCGCCCCTATTTCATTATTTTTGATGA
GGTAACAGCTTTTACTTCAACTTTAGATAAAAAAGAATTACAAGAAATGAATGATTATTTAATTAATATT
ATTATGAAAGGTCGTCAAGCTGGTGTATTTATGTTTTTAACAGCACAAAGACCAGATGCAGATGTGATTA
AAGGTAATGTGCGTGACCAATTAGGGTTACGTGTGTCTTTAGGTAATTTGTCAAATGATGGTTATCGTAT
GACCTTTGGTCAAACTGATAAAGAATTTCAAACGATTCATGATAGTGATATCGGCCGAGGTTATATTTCT
ATACTTGGACAATATAATGAACCAATTTTATTTGATGCACCTTTAATGGAACAATATGATTTTGTGGAAG
ATGTGAAACAAATATTAAATAAGGAGTGA
 Primer design