SecReT4
Protein ID: 87161643
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1485
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1640305..1640565 [-]
Producthypothetical protein
Component typeYddC
UniProt IDQ2FGJ8
KEGG IDsaa:SAUSA300_1485
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|87161643|ref|YP_494180.1| hypothetical protein SAUSA300_1485 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MSGLFNFFVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGGFLFLVSKGPE
QVFNAIAGVWKMIFGG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1640565-1640305 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
ATGAGTGGTTTATTTAATTTTTTTGTTTTAGGTGCTGACCGTCCATCACTTGGTGGAGTTGGTGACTGGA
TAAGTAATGAAGTAGGTACGGGTATTGGTTTAGTAGTATTGGTTGTTGGTATTGTAAAATGGGCTAGTGG
TAAATATGGGCATATGGTTATATTATTTGTTGTTGGTGGCTTTTTATTCTTAGTTTCTAAAGGTCCTGAA
CAGGTATTTAATGCGATTGCAGGTGTTTGGAAAATGATTTTTGGCGGTTGA
 Primer design