SecReT4
Protein ID: 87162078
T4SS name [ID]Ydd [622]
Gene symbol-
Locus tagSAUSA300_1483
StrainStaphylococcus aureus subsp. aureus USA300_FPR3757
Repliconchromosome [GenBank: NC_007793] [Browse all T4SS(s) in this replicon]
Location [Strand]1637380..1639875 [-]
Producthypothetical protein
Component typeYddE
UniProt IDQ2FGK0
KEGG IDsaa:SAUSA300_1483
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-24, Aligned region: 460..768
DUF87 [PF01935], Evalue: 2.9e-06, Aligned region: 460..637
Protein Sequence: 831 a.a.     [Download]
>gi|87162078|ref|YP_494178.1| hypothetical protein SAUSA300_1483 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MNLKAPYAGLRDNLLLTKTGEVWAYYRVRSESISTANYDAKEESKKRMRYFLESIKGYQDFHFEMYDHDL
DLRNKFKEISKDFDDEAFNVAEYYSKETIDVLEQELQMITHNSFVMGVKIRELADDAVTLKEILKSTLSD
TAERIVSNFGFDVNLDDKILDKYKTFERDLADSFLGIGGERLTENELAYIIRKPFISNATHDVQEESSRR
AITDIYNAVIDPTRLSVLEVENDNEKFYTTTVVVDDFPLDMEYTHLFEKAQNMPFPVECHVKAKIINNEK
VKKKFDRAKINHKQQAKEKQDTGDSASEDVQDNLFVLNQMEREVTGSGVFIEWVFMFVIKSDDYRDCKRK
AKRLMKRLKETQIYAVNPLADQLQLFYQCLHGNDLFINKYWLQRTTATGIAENLFGVSQSLGTKTGFYIG
RIDKFIRSVSREEAVASSRDIILFSLLLAAKGIKGAVSDSPHVLITGQTGKGKSFLAKLLWIYTSFFKGQ
MLYWDPKSEFAEWFDRVTESKEMQEKYPLFINHLKTFKYVTLNYEDSTNYGCLDPIVFLDGIEANEMLKS
VFDEIKSFENYHHIETAIYQAISDTVEERENGKKVGSLNVIEKLQNNEDEHVKNAGDLLFEKTQNNILKL
VFSDGTNPALNIQEKATILQVKGLDMPKADDDTSSYSTSEKNGITLMLLIGKFLEKFGSRRDVQTTIFID
EGWAFSASRQGKKVGKRIKRTGRSENNSLVFITQSVKDKADDDGGNFGCHFAFDEKDEREDILKSLGLEY
SKESPENMEMLKDLKKGQCIFSDFYGRVGKMVVHCPFEEMTEAFRTQEDSASSKAEEKFAM
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|87159884|ref|NC_007793.1|:c1639875-1637380 Staphylococcus aureus subsp. aureus USA300_FPR3757 chromosome, complete genome
ATGAATTTAAAAGCACCGTATGCAGGTTTAAGAGATAATTTGTTATTAACGAAAACTGGCGAAGTTTGGG
CGTATTATCGTGTTCGTTCTGAGTCTATATCAACAGCAAATTATGATGCAAAAGAAGAATCAAAAAAGCG
TATGCGTTATTTTTTAGAGTCGATTAAAGGTTATCAAGATTTTCATTTTGAAATGTATGACCACGATTTA
GATTTGCGAAATAAATTTAAAGAAATTAGTAAAGATTTTGATGATGAAGCTTTTAATGTAGCTGAATATT
ATTCAAAAGAAACTATTGACGTATTAGAACAAGAATTACAAATGATTACGCATAATTCTTTTGTTATGGG
TGTTAAAATACGTGAATTAGCTGACGATGCAGTTACACTTAAAGAGATTTTAAAAAGTACATTATCAGAT
ACGGCTGAGCGTATTGTTTCGAATTTTGGTTTTGATGTGAATTTAGACGATAAAATTTTAGATAAGTATA
AAACATTTGAACGAGATTTGGCTGATAGTTTTCTAGGTATTGGAGGCGAGCGTTTAACTGAGAATGAATT
GGCTTATATTATTAGAAAGCCTTTTATTTCAAATGCAACACATGACGTACAGGAAGAATCTTCAAGAAGA
GCTATTACAGATATTTATAATGCAGTAATTGACCCTACTCGCTTGAGTGTTTTAGAAGTTGAAAATGATA
ACGAGAAATTTTATACAACAACAGTTGTTGTTGATGATTTTCCGTTAGATATGGAATATACACATTTATT
TGAGAAAGCTCAAAATATGCCTTTTCCGGTTGAATGCCATGTAAAAGCAAAAATCATTAATAATGAGAAA
GTTAAGAAAAAATTTGACCGTGCGAAAATAAATCATAAACAACAAGCAAAAGAAAAGCAAGATACTGGCG
ACAGTGCTTCGGAAGATGTTCAAGATAATTTGTTTGTATTGAATCAAATGGAACGAGAAGTGACTGGCTC
AGGTGTATTTATTGAGTGGGTATTTATGTTTGTAATTAAAAGTGATGATTATAGAGATTGTAAACGTAAA
GCAAAGCGTTTGATGAAACGATTAAAGGAAACTCAAATATATGCAGTTAATCCATTAGCTGACCAGTTAC
AATTGTTTTATCAATGTTTACATGGTAATGATTTATTTATTAATAAGTATTGGTTACAAAGAACAACGGC
AACAGGTATAGCAGAGAATTTATTTGGTGTGTCTCAAAGTTTGGGAACAAAAACGGGTTTTTATATAGGG
CGTATTGATAAATTTATACGTTCTGTTTCACGTGAGGAAGCTGTTGCAAGTTCAAGGGATATAATTTTGT
TTAGTTTATTGTTGGCCGCAAAAGGTATTAAGGGGGCTGTCAGTGATAGTCCGCATGTTTTAATTACTGG
TCAAACTGGGAAAGGTAAATCATTTTTAGCAAAATTATTATGGATTTATACATCATTTTTTAAAGGTCAA
ATGTTGTACTGGGATCCAAAATCTGAGTTTGCAGAATGGTTTGACAGAGTAACAGAAAGTAAGGAAATGC
AAGAAAAGTATCCCCTATTTATTAATCATTTAAAAACATTTAAATATGTAACATTGAATTATGAAGATTC
AACCAATTATGGTTGTCTAGACCCTATTGTATTTTTAGATGGTATTGAAGCTAATGAGATGTTGAAATCA
GTGTTTGATGAAATTAAATCTTTTGAAAATTATCATCATATTGAAACAGCAATTTATCAAGCTATTTCTG
ATACGGTTGAAGAACGTGAAAATGGTAAAAAAGTTGGTTCATTAAATGTAATTGAAAAATTACAGAATAA
TGAAGATGAGCATGTAAAAAATGCAGGCGATTTATTATTTGAAAAAACGCAAAACAATATTTTAAAACTT
GTTTTTAGTGATGGTACGAATCCAGCTTTAAATATTCAAGAAAAAGCAACTATTTTACAGGTTAAAGGTT
TAGATATGCCTAAAGCAGATGATGATACATCAAGTTATTCAACAAGTGAGAAAAATGGGATTACATTAAT
GTTATTAATTGGTAAGTTTTTAGAGAAATTCGGTTCTCGTAGAGATGTTCAAACGACTATATTTATTGAT
GAGGGTTGGGCTTTTAGTGCTTCAAGACAAGGTAAAAAAGTTGGTAAGCGTATAAAAAGAACGGGACGTT
CTGAGAATAATTCACTTGTATTTATTACACAATCGGTAAAAGATAAAGCAGATGATGATGGTGGTAACTT
TGGTTGTCATTTTGCATTTGATGAAAAAGATGAACGTGAGGATATTTTAAAATCTTTAGGCTTAGAATAT
TCAAAAGAATCTCCTGAAAACATGGAGATGTTGAAAGATTTGAAGAAAGGTCAATGTATATTCAGTGATT
TTTATGGACGTGTTGGAAAAATGGTTGTACATTGTCCATTTGAGGAAATGACTGAAGCATTTAGAACACA
AGAAGATTCTGCAAGCTCTAAAGCTGAAGAAAAATTTGCGATGTAA
 Primer design