SecReT4
Protein ID: 87198334
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0309
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]334136..335332 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ2GBL6
KEGG IDnar:Saro_0309
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9e-59, Aligned region: 217..394
Protein Sequence: 398 a.a.     [Download]
>gi|87198334|ref|YP_495591.1| conjugation TrbI-like protein [Novosphingobium aromaticivorans DSM 12444]
MTGAVDTESREQPLVDPESAVKLRGDPPRVMRLSRKAIGLASAAACALVGGALIYALQPEGRKGAEELYN
TDGVAVADNLAGAPKDYGQVPKLGPPLPGDLGKPILDARQRGDVAALPPAGTGPATNPAADAAAAARQRA
EQEREAARGSRLFFGGGSAGSAAGSLASLPAGDEAPAVAPGAAPSSDAARRQAFLERTSDRRTVSGERLV
GLAAPAILQAGSVIPAALITGIRSDLPGLVTAQVTQNVYDSPTGRILLIPQGSRLIGDYDTDVAFGQNRV
LLAWNRLILPDGRSIVLERQPASDTQGFAGLQDGTDYHWGGVLKAALVSTLLGAGAELGSGDDGNLARAF
RRGTQDSINRAGEQIVSRELNVRPTLTIRPGFPVRVLVTRDLVLGAGQ
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c335332-334136 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGACCGGGGCGGTCGACACCGAAAGCCGGGAGCAGCCGCTGGTCGATCCCGAAAGCGCGGTGAAGCTGC
GCGGCGATCCACCGCGCGTCATGCGTCTGTCGCGCAAGGCCATCGGACTTGCCTCGGCTGCTGCCTGTGC
GCTGGTCGGCGGCGCCCTGATCTATGCCCTCCAGCCCGAGGGCCGAAAAGGCGCCGAAGAACTCTACAAC
ACCGATGGCGTCGCCGTGGCCGACAATCTCGCCGGGGCGCCCAAGGACTATGGTCAGGTGCCCAAGCTCG
GCCCACCACTTCCCGGCGATCTCGGCAAGCCCATCCTCGATGCCCGGCAGCGCGGCGATGTGGCCGCACT
GCCACCGGCCGGGACGGGACCCGCGACCAATCCCGCTGCGGACGCGGCCGCAGCCGCCCGGCAGCGCGCC
GAGCAGGAGCGCGAAGCCGCCCGCGGCAGCCGCCTGTTCTTCGGGGGCGGGAGCGCGGGCTCTGCCGCAG
GCAGTCTGGCCAGTCTGCCTGCGGGAGACGAGGCGCCGGCGGTTGCGCCCGGCGCGGCCCCTTCATCGGA
TGCGGCGCGCCGGCAGGCCTTCCTCGAGCGCACCAGCGACCGGCGGACGGTCTCGGGCGAACGGCTTGTG
GGGCTGGCCGCCCCTGCCATCCTCCAGGCAGGCTCGGTCATCCCGGCAGCCCTGATCACCGGCATCCGTT
CGGACCTGCCGGGGCTGGTGACCGCCCAGGTGACCCAGAACGTCTATGACAGCCCGACGGGGCGCATCCT
GCTGATCCCGCAGGGCTCGCGGCTGATTGGCGACTATGACACCGATGTCGCTTTCGGTCAGAACCGGGTC
CTGCTTGCCTGGAACCGGCTGATCCTGCCGGATGGCCGCTCGATCGTGCTCGAACGGCAGCCGGCTTCCG
ACACCCAGGGCTTTGCCGGGCTGCAGGACGGCACCGACTATCACTGGGGCGGGGTGCTCAAGGCGGCGCT
GGTCTCGACCCTGCTCGGCGCCGGCGCGGAACTGGGTTCCGGCGATGATGGCAATCTTGCCCGCGCCTTC
CGGCGCGGGACGCAGGACAGCATCAATCGCGCCGGCGAGCAGATCGTCAGCCGCGAACTCAACGTCCGGC
CGACGCTGACCATCCGTCCGGGCTTTCCGGTGCGGGTGCTAGTGACGCGCGACCTCGTTCTGGGAGCGGG
GCAATGA
 Primer design