SecReT4
Protein ID: 87198335
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0310
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]335329..336360 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ2GBL5
KEGG IDnar:Saro_0310
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-67, Aligned region: 114..337
Protein Sequence: 343 a.a.     [Download]
>gi|87198335|ref|YP_495592.1| conjugal transfer protein TrbG/VirB9/CagX [Novosphingobium aromaticivorans DSM 12444]
MINRTRCAPRTLTLAIASSSLVLAIPLQAREPAVNPPAAPAAVNETPQAPSSRSSVVAIPVPLPFPGQLK
SLPQAEPPAAGRSHPSRSHPAPRDRVGAANEAARVQPDRTGFINAIQLYPFTKGALYQVYARPGQVTDIA
LQPGERLVGAGPVASGDTVRWMIGDTVSGTGAAEQVHILVKPTRPDIATNLVINTDRRTYHLELRANPSV
YMASVSWTYPEDELIALRRAHAEAERAAPIAAGMDLASLDFRYRIEGDKPAWRPLRAFDDGTRVFIEFPE
SVAQGELPPLFVLGARGEAELVNYRVSGRYMIVDRLFAAAELRLGGRKGQDKVRIVTARRGRS
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c336360-335329 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGATCAACCGGACCCGGTGCGCGCCGCGCACCCTGACCCTCGCTATTGCCAGCTCGAGCCTCGTGCTCG
CCATTCCCCTGCAGGCCCGGGAACCCGCAGTGAACCCGCCTGCCGCGCCTGCGGCGGTCAACGAGACGCC
GCAGGCGCCTTCTTCGCGCTCCAGCGTGGTGGCCATCCCCGTACCGCTGCCGTTTCCCGGCCAGCTCAAA
TCTTTACCGCAGGCGGAGCCCCCCGCCGCGGGCCGCTCCCACCCGTCCCGGAGTCACCCCGCTCCGCGCG
ACCGGGTGGGAGCGGCAAACGAGGCGGCGCGCGTACAGCCGGATCGCACCGGGTTCATCAACGCGATCCA
GCTCTACCCCTTCACCAAGGGCGCACTCTATCAGGTCTATGCCAGGCCCGGACAGGTGACCGACATTGCG
CTCCAGCCCGGCGAACGTCTGGTCGGGGCGGGGCCAGTTGCTTCCGGCGATACCGTGCGGTGGATGATCG
GCGACACCGTCAGCGGCACCGGGGCCGCCGAACAGGTCCACATCCTCGTCAAACCGACCCGGCCCGACAT
CGCCACCAATCTCGTGATCAACACCGATCGGCGGACCTATCACCTCGAGCTGCGCGCCAATCCTTCCGTC
TACATGGCGTCTGTTTCCTGGACCTATCCAGAAGACGAACTGATCGCGCTGCGCCGGGCCCACGCCGAAG
CGGAGCGCGCGGCGCCGATCGCAGCCGGGATGGACCTCGCGAGCCTTGATTTCCGCTACCGGATCGAGGG
CGACAAGCCGGCCTGGCGACCGCTGCGCGCTTTCGACGACGGAACTCGCGTCTTCATCGAGTTCCCCGAA
AGCGTCGCGCAGGGCGAACTGCCGCCGCTGTTCGTGCTGGGGGCCCGCGGCGAGGCCGAGCTGGTCAATT
ACCGCGTCTCGGGCCGCTACATGATTGTCGACCGGCTCTTTGCCGCTGCCGAGCTTCGGCTTGGCGGGCG
CAAGGGCCAGGACAAGGTGCGGATCGTCACCGCGCGCCGAGGCCGGTCATGA
 Primer design