SecReT4
Protein ID: 87198336
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0311
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]336357..337040 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ2GBL4
KEGG IDnar:Saro_0311
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.9e-58, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|87198336|ref|YP_495593.1| conjugal transfer protein TrbF [Novosphingobium aromaticivorans DSM 12444]
MFRRPTIRYGRTPEPETPYQRAAQVWDDRIGSARVQARSWRLAFFGALGLSTCLTAGIIWQGARGSIVPW
VVEVDKLGEAQALAPADAGFAPSDPQIAFHLARFIEQVRSIPDDPIVVRQNWLRAYDFATDKGALALNDY
ARTNDPFALIGREQVGVDVTSVIRASPTSFRVAWVERRYRDGSLAETSRWTAILTTVVQPPRTPDALRKN
PLGIFVNAINWSKELGS
 
Nucleotide Sequence: 684 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c337040-336357 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGTTCCGACGCCCCACCATTCGTTATGGCAGGACTCCCGAACCCGAAACGCCCTACCAGCGCGCCGCCC
AGGTCTGGGATGACCGGATCGGCTCGGCCCGCGTTCAGGCCCGCAGCTGGCGACTCGCCTTCTTCGGCGC
GCTTGGCCTGTCGACCTGCCTGACCGCCGGGATCATCTGGCAGGGCGCACGCGGCAGCATTGTCCCCTGG
GTAGTCGAGGTCGACAAATTGGGCGAAGCCCAGGCCCTGGCCCCTGCGGATGCCGGTTTTGCACCGTCCG
ATCCCCAGATCGCCTTCCACCTCGCGCGCTTCATCGAGCAGGTTCGCAGCATCCCCGACGATCCGATCGT
CGTGCGCCAGAACTGGCTCAGGGCCTATGATTTCGCGACCGACAAGGGCGCGCTCGCCCTCAACGACTAT
GCCCGGACCAACGACCCCTTTGCGCTCATCGGGCGCGAACAGGTCGGCGTCGATGTCACCAGCGTGATCC
GGGCATCGCCGACCAGCTTCCGCGTCGCCTGGGTCGAGCGCCGCTACCGCGACGGCAGTCTCGCCGAGAC
AAGCCGCTGGACCGCGATCCTGACCACCGTCGTCCAGCCTCCGCGCACGCCTGATGCCCTGCGCAAGAAC
CCGCTCGGCATTTTCGTCAATGCCATCAACTGGTCGAAGGAACTCGGATCATGA
 Primer design